DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Sdk2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_766388.2 Gene:Sdk2 MGIID:2443847 Length:2176 Species:Mus musculus

Alignment Length:574 Identity:122/575 (21%)
Similarity:189/575 (33%) Gaps:188/575 (33%)


  Fly     2 LPPSWH----LIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVATGVVPN 62
            :|||..    |...|::|:..|.|:....:  |.:|...|..  .|:|         ..|..|.|
Mouse   158 IPPSSRIAITLENTLVILSTVAPDAGRYYV--QAVNDKNGDN--KTSQ---------PITLAVEN 209

  Fly    63 FGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFT-EYIENVTVPA 126
            .||.|       .|:|     .|::             :|..|.::|....|.| |.:.|    |
Mouse   210 VGGPA-------DPIA-----PTII-------------IPPKNTSVVAGTSEVTMECVAN----A 245

  Fly   127 GRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEE 191
            ...:||                           |::.:.....::....|.:|.  |.|.|....
Mouse   246 RPLIKL---------------------------HIVWKKDGAPLSSGISDYNRR--LTIANPTVS 281

  Fly   192 DRGRYMCQI----NTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGAN---------ISLRCRA 243
            |.|.|.|:.    ::|...|:..||:|:.||.          .|||...         :.:.|||
Mouse   282 DAGYYECEAMLRSSSVAPVTRGAYLSVLEPPQ----------FVREPERHITAEMEKVVDIPCRA 336

  Fly   244 SGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKV 308
            .|.|.|.|.|.: |.:.:.:.|.....:.....|:|:.:...|.|...|.|.|......:.....
Mouse   337 KGVPPPSITWYK-DAALVEVGKLTRFKQRSDGGLQISGLLPDDTGMLQCFAHNAAGEAQTSTYLA 400

  Fly   309 SVDFPPMLLIPHQLVGAP------EGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATV 367
            .....|      .:...|      :|.:|.:.|.|...|.....|.:||        :.....:|
Mouse   401 VTSIAP------NITRGPLDSTVIDGMSVVLACETSGAPRPAITWQKGE--------RILASGSV 451

  Fly   368 GLPAYKTHMKLTIINVSS--------GDDGIYKCVAKNPRG----ETDGII--RLYVSYPP---- 414
            .||      :.|::...|        .|.|.|.|:|.|.||    ..|.::  |..::.||    
Mouse   452 QLP------RFTLLESGSLLISPTHISDAGTYTCLATNSRGVDEASADLVVWARTRITKPPQDQS 510

  Fly   415 ----TTAS--SGIYSTDTH---------WGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLN-E 463
                |.||  .|:    ||         |.::|              :..|.:.|.|.:.:.| .
Mouse   511 VIKGTQASMVCGV----THDPRVTVRYVWEKDG--------------ATLAVETNPRIRLDRNGS 557

  Fly   464 IGLSEQKS--FLDKTQNPLLANGNANEADAESNGAR----GHNPSMAIAWLFVV 511
            :.:|:..|  ....|...|.|.||    |:.:...|    .|.|...:|.|..|
Mouse   558 LHISQTWSGDIGTYTCRVLSAGGN----DSRNAHLRVRQLPHAPEHPVATLSTV 607

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 19/100 (19%)
Ig 130..200 CDD:143165 12/70 (17%)
I-set 226..310 CDD:254352 20/93 (22%)
IGc2 233..298 CDD:197706 18/74 (24%)
Ig 313..410 CDD:299845 25/117 (21%)
IG_like 325..410 CDD:214653 24/105 (23%)
Sdk2NP_766388.2 IG_like 44..113 CDD:214653
IGc2 44..102 CDD:197706
IG_like 124..207 CDD:214653 14/62 (23%)
Ig 136..192 CDD:299845 10/36 (28%)
IG_like 226..308 CDD:214653 23/115 (20%)
IGc2 237..290 CDD:197706 16/86 (19%)
I-set 312..401 CDD:254352 21/100 (21%)
Ig 330..398 CDD:143165 17/69 (25%)
I-set 406..496 CDD:254352 24/110 (22%)
Ig 420..496 CDD:299845 22/90 (24%)
Ig 506..590 CDD:299845 22/106 (21%)
IG_like 506..590 CDD:214653 22/106 (21%)
FN3 594..685 CDD:238020 5/15 (33%)
FN3 697..790 CDD:238020
FN3 798..894 CDD:238020
FN3 899..987 CDD:238020
FN3 997..1091 CDD:238020
FN3 1103..1198 CDD:238020
FN3 1205..1294 CDD:238020
FN3 1305..1398 CDD:238020
FN3 1404..1488 CDD:238020
FN3 1507..1620 CDD:238020
FN3 1630..1723 CDD:238020
FN3 1728..1809 CDD:238020
FN3 1841..1920 CDD:238020
PDZ-binding. {ECO:0000269|PubMed:20219992} 2170..2176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.