DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Ptprq

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001357916.1 Gene:Ptprq MGIID:1096349 Length:2301 Species:Mus musculus

Alignment Length:330 Identity:62/331 (19%)
Similarity:118/331 (36%) Gaps:99/331 (30%)


  Fly   203 VTAKTQFGY-----LNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIA 262
            |.|:|..|.     |:|..||::..::....::..|...|.:..|....|..||...|   .:::
Mouse   375 VAAETSAGVGPKSNLSVFTPPDVPGAVFDLQIVEVEATEIRVSWRKPRQPNGIISQYR---VKVS 436

  Fly   263 INKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSV----------------- 310
            :.::.::       ||.|.::..|  .|:   :|.:.|.:...:...:                 
Mouse   437 VLESGVI-------LENTLLTGQD--EYI---NNPMTPEIMNLVDPMIGFYEGSGEMSSDLHSLA 489

  Fly   311 ---------DFPPMLLIPHQ----LVGAPEGFNVTIEC------------FTEAHPTSLNYWT-R 349
                     |||....:..|    :|.....:...|..            ||| |..|::.:| .
Mouse   490 SFIYNSHPHDFPARTRVEDQRSPVVVATRNQYMTDIAAEHLSYVIRRLVPFTE-HTISVSAFTVM 553

  Fly   350 GEGP--IIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSY 412
            ||||  ::....:.:|.:::.:..||        |:||....:|....:.|.|:    |..|..|
Mouse   554 GEGPPTVLTVRTREQVPSSIQIINYK--------NISSSSILLYWDPPEYPNGK----ITHYTIY 606

  Fly   413 PPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQ------SNLNEIGLSEQKS 471
            .....::..:...|      ::|::...|         ..|.|||:      :::.|..|||:..
Mouse   607 AMELDTNRAFQMTT------VDNSFLITG---------LKKYTRYKMRVAASTHVGESSLSEEND 656

  Fly   472 FLDKT 476
            ...:|
Mouse   657 LFVRT 661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 6/18 (33%)
Ig 130..200 CDD:143165
I-set 226..310 CDD:254352 14/84 (17%)
IGc2 233..298 CDD:197706 13/65 (20%)
Ig 313..410 CDD:299845 25/116 (22%)
IG_like 325..410 CDD:214653 22/100 (22%)
PtprqNP_001357916.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.