DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Igsf9b

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b MGIID:2685354 Length:1443 Species:Mus musculus

Alignment Length:387 Identity:96/388 (25%)
Similarity:149/388 (38%) Gaps:90/388 (23%)


  Fly    98 GANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKN--LGS---YKVAWMHFEQSAILTV 157
            |.|:.....:.:.|||||      ||..||..|.|.|.|.:  .|.   |.|.|..|.....:.:
Mouse    17 GKNLVPGGAHGLREEPEF------VTARAGEGVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIFI 75

  Fly   158 H-----NHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFG------- 210
            .     .||   :|..:.....||:..   |.:..|..||:|.|.|::  :....|:.       
Mouse    76 KFGYYPPHV---DPEYAGRASLHDKAS---LRLEQVRSEDQGWYECKV--LMLDQQYDTFHNGSW 132

  Fly   211 -YLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEG 274
             :|.:..||...:: ....:..:||.:|::.|.|.|:|:||:.|.: :.:.:..:..:.|::   
Mouse   133 VHLTINAPPTFTET-PPQYIEAKEGGSITMTCTAFGNPKPIVTWLK-EGTLLGASAKYQVSD--- 192

  Fly   275 DTLEITRISRLDMGAYLC----IASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIE- 334
            .:|.:|.:||.|.|||.|    |....|..|     .:.|..||.::.|      ||...|.|. 
Mouse   193 GSLTVTSVSREDRGAYTCRAYSIQGEAVHTT-----HLLVQGPPFIVSP------PENITVNISQ 246

  Fly   335 -----CFTEAHPTSLN---YWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIY 391
                 |..||:|.:|.   || :.|.....:..|.:|...:       ...|.|..|...|.|.|
Mouse   247 DALLTCRAEAYPGNLTYTWYW-QDENVYFQNDLKLRVRILI-------DGTLIIFRVKPEDAGKY 303

  Fly   392 KCVAKNPRGET-DGIIRLYVSYPPTTASS--------GIY------------STDTHWGENG 432
            .||..|..|.: .....|.|.||....:.        ||:            :|...|.::|
Mouse   304 TCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVKWNKDG 365

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/114 (24%)
Ig 130..200 CDD:143165 21/80 (26%)
I-set 226..310 CDD:254352 23/88 (26%)
IGc2 233..298 CDD:197706 21/69 (30%)
Ig 313..410 CDD:299845 28/107 (26%)
IG_like 325..410 CDD:214653 25/95 (26%)
Igsf9bXP_011240777.1 IG_like 32..117 CDD:214653 28/97 (29%)
Ig 43..117 CDD:143165 21/80 (26%)
I-set 141..227 CDD:254352 24/96 (25%)
IGc2 155..212 CDD:197706 20/61 (33%)
I-set 231..323 CDD:254352 27/106 (25%)
Ig 237..323 CDD:299845 25/94 (27%)
IG_like 333..416 CDD:214653 5/34 (15%)
Ig <355..416 CDD:299845 3/12 (25%)
IG_like 428..507 CDD:214653
Ig 444..507 CDD:299845
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.