DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Vsig10

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001028483.2 Gene:Vsig10 MGIID:2448533 Length:558 Species:Mus musculus

Alignment Length:486 Identity:98/487 (20%)
Similarity:147/487 (30%) Gaps:162/487 (33%)


  Fly   129 NVKLGCSVKNLGSYKVAWMH--FEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEE 191
            ||.|.|...:.....|.|..  .|.:.:::.::.:....||.|:       .....|.|..:..|
Mouse    60 NVTLRCGSASGSRGLVTWYRNDSEPAFLVSFNSSLPPAAPRFSL-------EDAGALRIEALRLE 117

  Fly   192 DRGRYMCQ--IN-----TVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRP 249
            |.|.|.||  :|     .|..:...|...|.|..:...:|.:..:....|:.:...|.::..|.|
Mouse   118 DDGNYTCQEVLNETHWFPVRLRV
ASGPAYVEVNISATGTLPNGTLYAARGSQVDFNCCSAAQPPP 182

  Fly   250 IIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDM-----GAYLCIASNGV----------- 298
            .::|         ..:.|.:.|:.|..|.....:.:.|     |.|.|.|:|.:           
Mouse   183 EVEW---------WIQTHSIPEFLGKNLSANSFTLMLMSQNLQGNYTCSATNVLSGRQRKVTTEL 238

  Fly   299 ----PPTVSKRIKVSVD---------------FPP-------------------MLLIPHQL--- 322
                ||..:.:..|.|.               :|.                   ..|.|.||   
Mouse   239 LV
YWPPPSAPQCSVEVSSESTTLELACNWDGGYPDPTFLWTEEPGGTIMGNSKLQTLSPAQLLEG 303

  Fly   323 -----VG----APE------------------------GFNVTIEC-FTEAHPTSLNYWTRG-EG 352
                 ||    .||                        |.|||:.| .:.|:|.:...|.|. ..
Mouse   304 KKFKCVGNHILGPESGASCVVKLSSPLLPSQPMRTCFVGGNVTLTCEVSGANPPARIQWLRNLTQ 368

  Fly   353 PIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSG-DDGIYKCVAKNPRGETDGIIRLYVSYP--- 413
            |.|..|..|.:      ........|||.|.|.. |:|.|.|.|:|..|.....|.|.|..|   
Mouse   369 PAIQPSSHYII------TQQGQSSSLTIHNCSQDLDEGFYYCQAENLVGVRATNIWLSVKEPLNI 427

  Fly   414 ----PTTAS---------SG--IYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNE 463
                .|..|         ||  :|.:...|.:.|    ..:.|.|....:...|.....:....|
Mouse   428 GGIVGTVVSLLLLGLAVVSGLTLYYSPAFWWKGG----STFRGQDMGDVMVLVDSEEEEEEEEEE 488

  Fly   464 IGLSEQKSFLDKTQNPLLANGNANEADAESN 494
                |:|..:            |.|.:.|:|
Mouse   489 ----EEKEDV------------AEEVEQETN 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/96 (23%)
Ig 130..200 CDD:143165 17/74 (23%)
I-set 226..310 CDD:254352 18/104 (17%)
IGc2 233..298 CDD:197706 15/70 (21%)
Ig 313..410 CDD:299845 36/155 (23%)
IG_like 325..410 CDD:214653 29/112 (26%)
Vsig10NP_001028483.2 Ig 47..135 CDD:299845 19/82 (23%)
IG_like 55..140 CDD:214653 20/87 (23%)
IG_like 160..240 CDD:214653 15/89 (17%)
Ig <184..238 CDD:299845 11/63 (17%)
IG_like 341..421 CDD:214653 27/86 (31%)
Ig 345..418 CDD:143165 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.