DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and IGSF9B

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:401 Identity:99/401 - (24%)
Similarity:151/401 - (37%) Gaps:99/401 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 STVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKN--LGS---YK 143
            ::|:|:.|:...|...         :.|||||      ||..||.:|.|.|.|.:  .|.   |.
Human    10 ASVIGTRGLAAEGAHG---------LREEPEF------VTARAGESVVLRCDVIHPVTGQPPPYV 59

  Fly   144 VAWMHFEQSAILTVH-----NHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTV 203
            |.|..|.....:.:.     .||   :|..:.....||:..   |.:..|..||:|.|.|::  :
Human    60 VEWFKFGVPIPIFIKFGYYPPHV---DPEYAGRASLHDKAS---LRLEQVRSEDQGWYECKV--L 116

  Fly   204 TAKTQFG--------YLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSR 260
            ....|:.        :|.:..||...:: ....:..:||.:|::.|.|.|:|:||:.|.::....
Human   117 MLDQQYDTFHNGSWVHLTINAPPTFTET-PPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTLL 180

  Fly   261 IAINKNHIVNEWEGDTLEITRISRLDMGAYLC----IASNGVPPTVSKRIKVSVDFPPMLLIPHQ 321
            .|..|..:    ...:|.:|.:||.|.|||.|    |....|..|     .:.|..||.::.|  
Human   181 GASGKYQV----SDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTT-----HLLVQGPPFIVSP-- 234

  Fly   322 LVGAPEGFNVTIE------CFTEAHPTSLN---YWTRGEGPIIHDSHKYKVEATVGLPAYKTHMK 377
                ||...|.|.      |..||:|.:|.   || :.|.....:..|.:|...:       ...
Human   235 ----PENITVNISQDALLTCRAEAYPGNLTYTWYW-QDENVYFQNDLKLRVRILI-------DGT 287

  Fly   378 LTIINVSSGDDGIYKCVAKNPRGET-DGIIRLYVSYPPTTASS--------GIY----------- 422
            |.|..|...|.|.|.||..|..|.: .....|.|.||....:.        ||:           
Human   288 LIIFRVKPEDSGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEP 352

  Fly   423 -STDTHWGENG 432
             :|...|.::|
Human   353 PATVVKWNKDG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/113 (24%)
Ig strand B 130..134 CDD:409405 2/3 (67%)
Ig strand C 143..147 CDD:409405 1/3 (33%)
Ig strand E 178..185 CDD:409405 1/6 (17%)
IgI_1_MuSK 218..310 CDD:409562 25/95 (26%)
Ig strand A 218..221 CDD:409562 1/2 (50%)
Ig strand A' 226..231 CDD:409562 0/4 (0%)
Ig strand B 237..244 CDD:409562 2/6 (33%)
Ig strand C 250..255 CDD:409562 2/4 (50%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 0/2 (0%)
Ig strand E 275..281 CDD:409562 1/5 (20%)
Ig strand F 288..295 CDD:409562 5/10 (50%)
Ig strand G 302..310 CDD:409562 0/7 (0%)
IG_like 325..410 CDD:214653 25/94 (27%)
Ig strand B 331..335 CDD:143207 2/9 (22%)
Ig strand C 344..348 CDD:143207 2/6 (33%)
Ig strand E 376..380 CDD:143207 1/3 (33%)
Ig strand F 390..395 CDD:143207 2/4 (50%)
Ig strand G 403..406 CDD:143207 0/2 (0%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 28/96 (29%)
Ig strand B 41..45 CDD:409353 2/3 (67%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
Ig strand E 96..100 CDD:409353 1/6 (17%)
Ig strand F 110..115 CDD:409353 2/4 (50%)
I-set 139..225 CDD:400151 25/95 (26%)
Ig strand B 157..161 CDD:409353 1/3 (33%)
Ig strand C 170..174 CDD:409353 1/3 (33%)
Ig strand E 191..195 CDD:409353 1/3 (33%)
Ig strand F 205..210 CDD:409353 3/4 (75%)
Ig strand G 218..221 CDD:409353 1/2 (50%)
Ig_3 228..307 CDD:464046 25/92 (27%)
Ig 336..410 CDD:472250 5/28 (18%)
Ig strand B 342..346 CDD:409353 0/3 (0%)
Ig strand C 355..360 CDD:409353 1/4 (25%)
Ig strand E 380..384 CDD:409353
Ig strand F 394..399 CDD:409353
Ig strand G 407..410 CDD:409353
Ig 429..505 CDD:472250
Ig strand B 438..442 CDD:409353
Ig strand C 451..455 CDD:409353
Ig strand E 471..475 CDD:409353
Ig strand F 485..490 CDD:409353
FN3 <490..>731 CDD:442628
Ig strand G 498..501 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
PHA03247 <894..1242 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.