DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and IGSF9B

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_011540993.1 Gene:IGSF9B HGNCID:32326 Length:1539 Species:Homo sapiens

Alignment Length:374 Identity:95/375 (25%)
Similarity:141/375 (38%) Gaps:90/375 (24%)


  Fly   111 EEPEFTEYIENVTVPAGRNVKLGCSVKN--LGS---YKVAWMHFEQSAILTVH-----NHVITRN 165
            |||||      ||..||.:|.|.|.|.:  .|.   |.|.|..|.....:.:.     .||   :
Human   126 EEPEF------VTARAGESVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHV---D 181

  Fly   166 PRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFG--------YLNVVVPPNIDD 222
            |..:.....||:..   |.:..|..||:|.|.|::  :....|:.        :|.:..||...:
Human   182 PEYAGRASLHDKAS---LRLEQVRSEDQGWYECKV--LMLDQQYDTFHNGSWVHLTINAPPTFTE 241

  Fly   223 SLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDM 287
            : ....:..:||.:|::.|.|.|:|:||:.|.::.....|..|..:    ...:|.:|.:||.|.
Human   242 T-PPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTLLGASGKYQV----SDGSLTVTSVSREDR 301

  Fly   288 GAYLC----IASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIE------CFTEAHPT 342
            |||.|    |....|..|     .:.|..||.::.|      ||...|.|.      |..||:|.
Human   302 GAYTCRAYSIQGEAVHTT-----HLLVQGPPFIVSP------PENITVNISQDALLTCRAEAYPG 355

  Fly   343 SLN---YWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGET-D 403
            :|.   || :.|.....:..|.:|...:       ...|.|..|...|.|.|.||..|..|.: .
Human   356 NLTYTWYW-QDENVYFQNDLKLRVRILI-------DGTLIIFRVKPEDSGKYTCVPSNSLGRSPS 412

  Fly   404 GIIRLYVSYPPTTASS--------GIY------------STDTHWGENG 432
            ....|.|.||....:.        ||:            :|...|.::|
Human   413 ASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVKWNKDG 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/114 (24%)
Ig 130..200 CDD:143165 21/80 (26%)
I-set 226..310 CDD:254352 24/88 (27%)
IGc2 233..298 CDD:197706 22/69 (32%)
Ig 313..410 CDD:299845 28/107 (26%)
IG_like 325..410 CDD:214653 25/95 (26%)
IGSF9BXP_011540993.1 IG_like 128..213 CDD:214653 28/97 (29%)
Ig 139..213 CDD:143165 21/80 (26%)
I-set 237..323 CDD:254352 25/96 (26%)
IGc2 251..308 CDD:197706 21/61 (34%)
I-set 327..419 CDD:254352 27/106 (25%)
Ig 333..419 CDD:299845 25/94 (27%)
IG_like 429..512 CDD:214653 5/34 (15%)
Ig <451..512 CDD:299845 3/12 (25%)
IG_like 524..603 CDD:214653
Ig 533..603 CDD:299845
FN3 608..703 CDD:238020
FN3 719..801 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.