DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and SDK1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_689957.3 Gene:SDK1 HGNCID:19307 Length:2213 Species:Homo sapiens

Alignment Length:625 Identity:143/626 (23%)
Similarity:207/626 (33%) Gaps:203/626 (32%)


  Fly    12 LLVLAATAGDSTNKIILPQILNGGGG------------GGGVGTAQGKHPSGSKTVATGVVPNFG 64
            |::||.|..|:....:  |.:|...|            ...|||.:...|       |.|||   
Human   246 LVILATTTSDAGAYYV--QAVNEKNGENKTSPFIHLSIARDVGTPETMAP-------TIVVP--- 298

  Fly    65 GAAGNGAGGGGPVAGSG-TGSTVVGS-------------NGVIVAGG----GANVPTSN------ 105
                  .|....||||. |....:.|             |||.:..|    |..:..||      
Human   299 ------PGNRSVVAGSSETTLECIASARPVEDLSVTWKRNGVRITSGLHSFGRRLTISNPTSADT 357

  Fly   106 ---------------------LNIVVEEPEFTEYIEN-VTVPAGRNVKLGCSVKNLGSYKVAWMH 148
                                 ...::|.|.||...|: ::......|.:||....:....:.|. 
Human   358 GPYVCEAALPGSAFEPARATAFLFIIEPPYFTAEPESRISAEVEETVDIGCQAMGVPLPTLQWY- 421

  Fly   149 FEQSAILTVHNHVITR--NPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMC-------QINTVT 204
              :.||      .|:|  |||..|.       .:..|.|..:..||.|.:.|       :|.|.|
Human   422 --KDAI------SISRLQNPRYKVL-------ASGGLRIQKLRPEDSGIFQCFASNEGGEIQTHT 471

  Fly   205 AKTQFGYLNVVVPPNIDDSLSSS--DVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNH 267
                  ||:|.   ||....:..  |..|.:|....|||..||:|:|.|.|||:         ||
Human   472 ------YLDVT---NIAPVFTQRPVDTTVTDGMTAILRCEVSGAPKPAITWKRE---------NH 518

  Fly   268 IVNE----------WEGDTLEITRISRLDMGAYLCIASN-----GVPPTVSKRIKVSVDFPPMLL 317
            |:..          .|...|:|..:...|.|.|.|.|:|     ....|::...:.|:..||.  
Human   519 ILASGSVRIPRFMLLESGGLQIAPVFIQDAGNYTCYAANTEGSLNASATLTVWNRTSIVHPPE-- 581

  Fly   318 IPHQLVGAPEGFNVTIECFTEAHP-TSLNY-WTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTI 380
             .|.::   :|...|:.|.....| .||.| |.:....:...|....|....|        .|.|
Human   582 -DHVVI---KGTTATLHCGATHDPRVSLRYVWKKDNVALTPSSTSRIVVEKDG--------SLLI 634

  Fly   381 INVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPP--------TTASSGIYSTDTHW-----GENG 432
            ....|||.|.|.|...:..|....:.||.|...|        :..||..::....|     |.:.
Human   635 SQTWSGDIGDYSCEIVSEGGNDSRMARLEVIELPHSPQNLLVSPNSSHSHAVVLSWVRPFDGNSP 699

  Fly   433 I--------NNNYAYG------GPDSTR-SIYAQDKNTRYQSN---LNEIG---LSEQKSFLDKT 476
            |        .||..:.      ||:.|. ::........||..   :||:|   .|.:.|.|...
Human   700 ILYYIVELSENNSPWKVHLSNVGPEMTGVTVSGLTPARTYQFRVCAVNEVGRGQYSAETSRLMLP 764

  Fly   477 QNP-------LLANGNANEA---------DAESNGA-RGH 499
            :.|       ::|:|..|::         :.|.||. ||:
Human   765 EEPPSAPPKNIVASGRTNQSIMVQWQPPPETEHNGVLRGY 804

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 25/106 (24%)
Ig 130..200 CDD:143165 18/79 (23%)
I-set 226..310 CDD:254352 28/101 (28%)
IGc2 233..298 CDD:197706 24/80 (30%)
Ig 313..410 CDD:299845 25/99 (25%)
IG_like 325..410 CDD:214653 22/87 (25%)
SDK1NP_689957.3 I-set 104..188 CDD:254352
Ig 122..176 CDD:143165
Ig 219..265 CDD:299845 6/21 (29%)
IGc2 312..364 CDD:197706 8/52 (15%)
I-set 386..475 CDD:254352 27/111 (24%)
Ig 404..472 CDD:143165 21/90 (23%)
I-set 480..570 CDD:254352 27/99 (27%)
Ig 494..570 CDD:299845 25/85 (29%)
I-set 575..664 CDD:254352 26/103 (25%)
Ig 580..664 CDD:299845 24/98 (24%)
FN3 668..759 CDD:238020 17/91 (19%)
fn3 771..857 CDD:278470 8/35 (23%)
FN3 872..967 CDD:238020
FN3 972..1054 CDD:238020
FN3 1070..1166 CDD:238020
FN3 1176..1271 CDD:238020
fn3 1279..1365 CDD:278470
FN3 1378..1471 CDD:238020
FN3 1477..1572 CDD:238020
FN3 1580..1694 CDD:238020
FN3 1704..1797 CDD:238020
FN3 1802..1883 CDD:238020
FN3 1903..1996 CDD:238020
PDZ-binding. {ECO:0000250|UniProtKB:Q6V4S5} 2207..2213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.