DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and zig-3

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans

Alignment Length:256 Identity:62/257 (24%)
Similarity:104/257 (40%) Gaps:49/257 (19%)


  Fly   187 NVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPII 251
            :.|....|.....::.:..:....:|.......|.:.|  .|..|..|.:::|||....:|..:|
 Worm    13 SAHPLSSGEMRAAVSNLVREIDSTHLTTKPSLKIIEGL--EDNTVSTGESVTLRCDVLSTPTGVI 75

  Fly   252 KWKRDDNSRIAINKNHIVNEWE------GDTLE---ITRISRL------DMGAYLCIASNGVPPT 301
            .|:: |..||..:|.  :|.:|      |.|:|   ||...::      .:|:|.|:|:|| ..|
 Worm    76 YWEK-DGQRIQGDKE--LNVFEKVLNAMGPTVESGIITSSYQIPCANLHHIGSYKCVATNG-HDT 136

  Fly   302 VSKRIKVSVD-----------FPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNY-WTRGEGPI 354
            |....|:||:           ..|::.:..:.....:....|:.|..:..   .|: |...:..|
 Worm   137 VESSAKISVEGQTVKCKSTRRSAPVITMSTESRFELQDNAATLICRADRR---ANWNWMFEDKKI 198

  Fly   355 IHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPT 415
            ..||.:|::     ||:    ..|.|..:...|.|.|.|:|.|..||:.|...||    ||
 Worm   199 DFDSGRYEL-----LPS----GDLLIRKIQWSDMGSYFCIAHNKYGESRGETFLY----PT 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 3/29 (10%)
Ig 130..200 CDD:143165 2/13 (15%)
I-set 226..310 CDD:254352 30/99 (30%)
IGc2 233..298 CDD:197706 24/80 (30%)
Ig 313..410 CDD:299845 24/98 (24%)
IG_like 325..410 CDD:214653 23/86 (27%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 32/106 (30%)
Ig 61..142 CDD:143165 25/85 (29%)
IG_like 177..244 CDD:214653 22/79 (28%)
Ig <191..237 CDD:299845 17/55 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.