DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and zig-2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans

Alignment Length:236 Identity:61/237 (26%)
Similarity:92/237 (39%) Gaps:65/237 (27%)


  Fly   218 PNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRI 282
            |.:..:.:.:|..|..|....|.|.|:|:|.|.|.|:.:.   :.|......|.:|....:..::
 Worm    31 PLLKFTRTPNDSNVTFGEKFVLSCGANGAPLPSIYWELNG---MRIQGEETSNVYENILNDGKQV 92

  Fly   283 SRLDM---------------GAYLCIASNGVPPT--VSK------------------RIKVSVDF 312
            |...|               |||.||..||:...  |:|                  .|.::|||
 Worm    93 SNAAMVSSHYRIPCATARNSGAYKCIIDNGLTKLEHVAKVFVGGNKTNCALNDNGAPFISMTVDF 157

  Fly   313 PPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNY-WTRGEGPIIHDSHKYKVEATVGLPAYKTHM 376
              .|.|.:..        |.:.|.:|   |:..: |.:||..:.:|..:|::     .|:    .
 Worm   158 --RLEISNNA--------VALSCRSE---TATEWSWHKGEQLLTNDGERYQM-----FPS----G 200

  Fly   377 KLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTA 417
            .|.|.|:|..|.|.|.|.|:|..|||..|..||    ||.|
 Worm   201 DLIIRNISWSDMGEYNCTARNHFGETTAITFLY----PTLA 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653
Ig 130..200 CDD:143165
I-set 226..310 CDD:254352 26/119 (22%)
IGc2 233..298 CDD:197706 21/80 (26%)
Ig 313..410 CDD:299845 28/98 (29%)
IG_like 325..410 CDD:214653 26/86 (30%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 25/103 (24%)
Ig 34..121 CDD:299845 21/90 (23%)
Ig <179..232 CDD:299845 20/62 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.