DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Cntn3

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_032805.2 Gene:Cntn3 MGIID:99534 Length:1028 Species:Mus musculus

Alignment Length:348 Identity:87/349 (25%)
Similarity:138/349 (40%) Gaps:57/349 (16%)


  Fly    77 VAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPA--GRNVKLGCSVKNL 139
            |..:.|.:.|:||...:|......:......|.|:.||        |:||  |..|:|.|.....
Mouse   198 VTSTVTNTRVLGSPTPLVLRSDGVMGEYEPKIEVQFPE--------TLPAAKGSTVRLECFALGN 254

  Fly   140 GSYKVAW-----MHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQ 199
            ...::.|     |.|.....|...|.:                     |.|.|..:||.|.|.|.
Mouse   255 PVPQINWRRSDGMPFPNKIKLRKFNGM---------------------LEIQNFQQEDTGSYECI 298

  Fly   200 INTVTAK-TQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAI 263
            ......| ...|.|.....|.....|...::.|.:  ::...|||||.|:|..:|.::.::.:..
Mouse   299 AENSRGKNVARGRLTYYAKPYWLQLLRDVEIAVED--SLYWECRASGKPKPSYRWLKNGDALVLE 361

  Fly   264 NKNHIVNEWEGDTLEITRISRLDMGAYLCIASN--GVPPTVSKRIKVSVDFPPMLLIP-HQLVGA 325
            .:..|    |...|.||.::..|.|.:.|||.|  |:..: |..:||....|.....| .::|..
Mouse   362 ERIQI----ENGALTITNLNVTDSGMFQCIAENKHGLIYS-SAELKVVASAPDFSRNPMKKMVQV 421

  Fly   326 PEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGI 390
            ..|..|.::|...|.|.:|::|.:|:..:       :.:|.|   ::.....|.|:||:..|.|.
Mouse   422 QVGSLVILDCKPRASPRALSFWKKGDMMV-------REQARV---SFLNDGGLKIMNVTKADAGT 476

  Fly   391 YKCVAKNPRGETDGIIRLYVSYP 413
            |.|.|:|..|:.:|...|.|:.|
Mouse   477 YTCTAENQFGKANGTTHLVVTEP 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 23/104 (22%)
Ig 130..200 CDD:143165 16/75 (21%)
I-set 226..310 CDD:254352 24/86 (28%)
IGc2 233..298 CDD:197706 20/67 (30%)
Ig 313..410 CDD:299845 26/98 (27%)
IG_like 325..410 CDD:214653 23/85 (27%)
Cntn3NP_032805.2 Ig 25..118 CDD:299845
I-set 26..117 CDD:254352
Ig 120..214 CDD:299845 5/16 (31%)
IG_like 130..205 CDD:214653 2/7 (29%)
Ig 227..315 CDD:299845 27/117 (23%)
IG_like 234..313 CDD:214653 25/108 (23%)
I-set 318..403 CDD:254352 25/92 (27%)
Ig 320..403 CDD:299845 24/90 (27%)
I-set 408..496 CDD:254352 26/98 (27%)
Ig 424..496 CDD:299845 23/82 (28%)
IG_like 506..594 CDD:214653
Ig 515..598 CDD:299845
FN3 598..695 CDD:238020
FN3 703..795 CDD:238020
FN3 805..898 CDD:238020
FN3 906..991 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.