DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and DSCAM

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001380.2 Gene:DSCAM HGNCID:3039 Length:2012 Species:Homo sapiens

Alignment Length:579 Identity:127/580 (22%)
Similarity:170/580 (29%) Gaps:181/580 (31%)


  Fly    74 GGPVAGSGTGSTVVGSNGV--IVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSV 136
            |..|:.....|:.|...||  ..|...|.|......|.|..|.....::|:|..|||:..:.|.|
Human   463 GNVVSYLNISSSQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRV 527

  Fly   137 KNLGSYKVAWMHFEQSAILTV-HNHVITRN-------------------------PRISVTHDKH 175
            .....|.:.|  ::.|.:|.. |..|...|                         |::|.:...|
Human   528 IGYPYYSIKW--YKNSNLLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVH 590

  Fly   176 DRHR----------------------------------TWY----------------------LH 184
            ...:                                  ||.                      |.
Human   591 VTVKVPPFIQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDGRPIPGSLGVTIDNIDFTSSLR 655

  Fly   185 INNVHEEDRGRYMC-QINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPR 248
            |:|:.....|.|.| ..|...|......|.|.|||.........|.|.  |..:.|.|.|.|.|.
Human   656 ISNLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRDQDGIY--GKAVILNCSAEGYPV 718

  Fly   249 PIIKWKRDD------------NSRIAINKN------HIVNEWEGDTLEITRISRLDMGAYLCIAS 295
            |.|.||...            |.||.:..|      |:|.|              |.|.|||..|
Human   719 PTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEE--------------DSGYYLCKVS 769

  Fly   296 NGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHK 360
            |.|...|||.:.::|..|.|:........|.:|....:.|........:..|.:.:..|..:..:
Human   770 NDVGADVSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRWEKEDRIINPEMAR 834

  Fly   361 YKVEA-TVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYST 424
            |.|.. .||.....|   |.|:.....|.|.:.|.|.|..||..|||:|.|..||......|...
Human   835 YLVSTKEVGEEVIST---LQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPPEIEIKDV 896

  Fly   425 DT-----HWGENGINNNYAYGG----------------------------------PDSTRSI-- 448
            ..     .| ..|.:.|....|                                  |.||.||  
Human   897 KARTITLRW-TMGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRM 960

  Fly   449 YAQDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGARGHNPSMAIAW 507
            ||:          |.||.||..:.|..|.:....:|...|...|...::    |:.:.|
Human   961 YAK----------NRIGKSEPSNELTITADEAAPDGPPQEVHLEPISSQ----SIRVTW 1005

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 29/179 (16%)
Ig 130..200 CDD:143165 20/153 (13%)
I-set 226..310 CDD:254352 30/102 (29%)
IGc2 233..298 CDD:197706 24/83 (29%)
Ig 313..410 CDD:299845 25/98 (26%)
IG_like 325..410 CDD:214653 23/86 (27%)
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449 7/25 (28%)
IGc2 518..575 CDD:197706 11/59 (19%)
I-set 596..686 CDD:333254 11/90 (12%)
Ig_DSCAM 707..784 CDD:143211 27/91 (30%)
Ig 802..889 CDD:325142 25/90 (28%)
FN3 885..978 CDD:238020 20/104 (19%)
FN3 986..1083 CDD:238020 5/25 (20%)
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. {ECO:0000250|UniProtKB:Q9ERC8} 1617..2012
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.