DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and wrk-1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001024651.1 Gene:wrk-1 WormBaseID:WBGene00006942 Length:452 Species:Caenorhabditis elegans

Alignment Length:488 Identity:91/489 (19%)
Similarity:163/489 (33%) Gaps:108/489 (22%)


  Fly    91 GVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAIL 155
            |:::|...|.:.|....::.:|              |.::.|.|.|:: .|..:.|.  :.:.::
 Worm    10 GLLIASTSAQIRTKGGTLIAKE--------------GESLTLRCEVED-PSVAIIWR--KNTEVV 57

  Fly   156 TVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQIN------TVTAKTQ-FGYLN 213
            .|.:.::.......::.:    ..|..|.|..|...:...|.|.:.      |...|.| |....
 Worm    58 AVDDEILDTYGGYEISME----GSTSVLTIKRVEPINSANYSCALAEPEVSVTFVIKVQVFKPTQ 118

  Fly   214 VVVPPNIDDSLSSSDVIVREG-ANISLRCRA-SGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDT 276
            |.|.|.:..|..:.....|.| .|:.:.|.. .|:|:|.:.|.:    :.|.....|..|..|..
 Worm   119 VSVKPLVVISPDTGVYHARVGEKNLVITCHVKEGNPKPGVVWTK----QAAKLPEDIKREHGGAR 179

  Fly   277 LEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFP--------PMLLIPHQLVGAPEGFNVTI 333
            :.||.:.:...|.|.|:|.| :..:....|.:.|..|        |.:......:...:..|.:.
 Worm   180 IVITEVKKHHAGKYNCLAEN-IAGSDRATIDIHVAEPLQGEREEKPWVKNEDTFIPVRKNQNASF 243

  Fly   334 ECFTEAHPTSLNYWTRGEGPIIHDSHKYK--VEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAK 396
            .|..:..|.....|......|..:..|:|  .|....|..| :...||:.::|....|.|.|...
 Worm   244 WCTYDGTPVPQVEWLFNGYKINFNDEKFKKTSETAQRLNGY-SKSTLTVGDISEEAFGDYACRIS 307

  Fly   397 NPRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQ--- 458
            |..|....::  :||..|.........::..|                  ::.|.||...||   
 Worm   308 NKLGSVTAVV--HVSGRPGPPQLSFDESELTW------------------TVRAFDKILEYQLCH 352

  Fly   459 ----------SNLNEIGLSEQ--------------KSFLD---------KTQNPLLANGNANEA- 489
                      .:.|.:.:.:.              .:||:         |.:|.|.....|.:| 
 Worm   353 RLENADHFLPEDCNSVRVKKSDNNGDDKWTHTIDLSTFLEHGNKYHVQLKARNALGWGSMAKDAL 417

  Fly   490 -----DAESNGARGHNPSMAIAWLFVVIATLLL 517
                 ..|...|:|.:....|:.:.|.:.|:.|
 Worm   418 HVELQRIEKEEAKGASIISIISSILVTLVTMYL 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 18/103 (17%)
Ig 130..200 CDD:143165 12/70 (17%)
I-set 226..310 CDD:254352 20/86 (23%)
IGc2 233..298 CDD:197706 18/67 (27%)
Ig 313..410 CDD:299845 20/107 (19%)
IG_like 325..410 CDD:214653 18/87 (21%)
wrk-1NP_001024651.1 IG_like 25..113 CDD:214653 17/109 (16%)
IGc2 31..96 CDD:197706 13/86 (15%)
IG_like 132..212 CDD:214653 20/85 (24%)
IGc2 142..202 CDD:197706 17/65 (26%)
IG_like 235..320 CDD:214653 19/88 (22%)
Ig 245..318 CDD:143165 17/76 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.