DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and rig-3

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans

Alignment Length:451 Identity:93/452 (21%)
Similarity:166/452 (37%) Gaps:64/452 (14%)


  Fly    93 IVAGGGANVPTSN-LNIVVEEPEFTEYIEN-VTVPAGRNVKLGC---SVKNLGSYKVAWMHFEQS 152
            :.|...::.|:|| .|.:|...|..:|..| :||..|:.:.:.|   |.:.:....:.|..    
 Worm    18 VSAVSASDSPSSNEANPIVISSEAMDYDTNTITVREGKKLMVSCVFESDEQIHKSDLLWKQ---- 78

  Fly   153 AILTVHNHVITRNPRI--SVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVV 215
              ...:|.....||.:  .:.::|..:||...||.::||..|.|.|.|...|...:.....:.:|
 Worm    79 --ANGNNIDGESNPSLFSVILNEKGSKHRKTSLHFSSVHTRDTGLYTCTGRTAGGENFEKTIKLV 141

  Fly   216 VPPNID--DSLSSSDVIVREGANISLRCRASGSPRPIIKWKR------DDNSRIAINKNHIVNEW 272
            |.|.|:  |..:....::.|...|....:......|:|:...      |:...........::..
 Worm   142 VLPAIEWNDKDTVKGALLGEPITIDCGVKGPSGKEPMIQMTNGNGEPLDEEIWTIAGNEATIDSL 206

  Fly   273 EGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPP---------MLLIPHQLVGAPEG 328
            :.:..|:| :|.:.:..:...:....|....|.:.:.|...|         ..:|.:.:..|...
 Worm   207 KKEHAELT-VSCITIEMHQETSKEEFPVVDRKDVNIEVYTLPEFETEESVQYTVIDNHVRDAIIY 270

  Fly   329 FNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKC 393
            .||     |.:.|...:|........|..|.|:.:...||: :...|:|  |.||:..|.|.|||
 Worm   271 CNV-----THSFPPVRHYTFYHGDEEIKMSDKFNIFVNVGV-SQGAHLK--IHNVNENDLGTYKC 327

  Fly   394 VAKNPRGETDGIIRLYVSYPPTTASSGIYSTDTH---WGENGINNNYAYGGPD------STRSIY 449
            .|.|.:.::...|.|..:..|......:.....|   |....|:.:     ||      ..|.:.
 Worm   328 EANNIKAKSYHTIHLREANAPAEPKVTLIEDKRHSIIWKVESIDRD-----PDLPMTAVEIRHLR 387

  Fly   450 AQDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGAR-GHNPSMAIAWLF 509
            |   .|...|.:::..:|:.   ..|:.:..:.....::...|.||.| ||.    ..|.|
 Worm   388 A---GTAEASGVSDEDISDA---YWKSHSIFMQRNIKDDGIYEINGLRHGHE----YVWRF 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 23/102 (23%)
Ig 130..200 CDD:143165 17/75 (23%)
I-set 226..310 CDD:254352 10/90 (11%)
IGc2 233..298 CDD:197706 8/71 (11%)
Ig 313..410 CDD:299845 27/106 (25%)
IG_like 325..410 CDD:214653 25/85 (29%)
rig-3NP_509155.1 IG_like 48..142 CDD:214653 22/100 (22%)
Ig 267..341 CDD:319273 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.