DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and igcm-2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_509073.3 Gene:igcm-2 WormBaseID:WBGene00020130 Length:718 Species:Caenorhabditis elegans

Alignment Length:499 Identity:106/500 (21%)
Similarity:161/500 (32%) Gaps:163/500 (33%)


  Fly   100 NVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITR 164
            |||.     |:..|.....|..   ..|.::...|..:...|.::.|...||         :|:.
 Worm    37 NVPP-----VIISPSKNAIIHK---KVGADLIFECKAEGAPSPEITWSRNEQ---------IIST 84

  Fly   165 NPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNID-DSLSSSD 228
            :|               .|.::|:.|.|:|.|.|                 :..||: :|.||.|
 Worm    85 SP---------------VLTLSNLEEGDKGLYTC-----------------LAVNIEGNSTSSID 117

  Fly   229 V---------------IVREGANISLRCRASGSPRPI-IKW----KRDDNSRIAINKNHIVNEWE 273
            |               .|.||:|:...|.|:.....| ..|    |....:.:.:..    |...
 Worm   118 VRFTKATILDLIPLNKTVIEGSNVFWHCHANAQATAISYSWLFEKKPIKTTSLGLRS----NIRS 178

  Fly   274 GDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLV-GAPEGFNVTIECFT 337
            || |.:..:.:.|.|.|.|.|.|....|.|....:.|.:||..|..||.| ....|.|.|:.|..
 Worm   179 GD-LSLQDVRKSDSGWYTCEAKNSAGETTSSTAYLHVFYPPEPLSSHQPVQTVASGRNTTVSCDV 242

  Fly   338 EAHPTSLNY-WTR----------------------------------GEGPIIHDSHKYKVEATV 367
            .|:||..:| |::                                  |:|.|: ::|....|..|
 Worm   243 IANPTPTSYTWSKNGHYLPTQASSHIIISYAKPGDGGIYGCQADNIAGKGSIV-ETHLIVAEPPV 306

  Fly   368 GLPAYKTHMK----------------------------------LTIINVSSGDDGIYKCVAKNP 398
            ...|..:.:|                                  ||...|...|.|.|:||..|.
 Worm   307 FTVAPPSEIKVRLGDQVSIPCQGFGDPMPIVYWIRDKKRINQSTLTFKKVEHLDHGAYECVVANS 371

  Fly   399 RGETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNYAY-GGPDSTRSIYAQD----KNTRYQ 458
            .......:.|.|.......:|.|..|..:.....|:....| ||.|.|.:::||:    :.|..:
 Worm   372 VETISTRVMLLVEITKPQMASSIKFTCLNSSSMRISWTPGYNGGFDQTFAVHAQNDVTLQWTSIK 436

  Fly   459 SNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGARGHNPS 502
            ::|||..|...:.|:            :.....||..|:|...|
 Worm   437 TSLNETILDHLEPFV------------SYRVSIESVNAKGSTNS 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 15/96 (16%)
Ig 130..200 CDD:143165 14/70 (20%)
I-set 226..310 CDD:254352 24/104 (23%)
IGc2 233..298 CDD:197706 18/70 (26%)
Ig 313..410 CDD:299845 33/167 (20%)
IG_like 325..410 CDD:214653 27/154 (18%)
igcm-2NP_509073.3 I-set 40..116 CDD:254352 23/125 (18%)
IGc2 56..110 CDD:197706 17/95 (18%)
IG_like 130..214 CDD:214653 21/89 (24%)
IGc2 137..203 CDD:197706 18/71 (25%)
IG_like 225..301 CDD:214653 15/77 (19%)
IGc2 232..290 CDD:197706 9/58 (16%)
I-set 305..383 CDD:254352 13/78 (17%)
Ig 323..379 CDD:143165 9/56 (16%)
FN3 392..464 CDD:238020 20/84 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.