DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and syg-1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001123159.1 Gene:syg-1 WormBaseID:WBGene00006365 Length:730 Species:Caenorhabditis elegans

Alignment Length:536 Identity:111/537 (21%)
Similarity:172/537 (32%) Gaps:160/537 (30%)


  Fly    40 GVGTAQGKHPSGSKTVATGVVPNFGGAAGNGAGG--------------GGPVAGSGTGSTVVGSN 90
            |:||.:.|...|:|..      ...|:|.||...              ...::.|.....||.|.
 Worm    61 GLGTDRDKPLPGNKRY------RMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSK 119

  Fly    91 GVIVAGGGANVPTSNLNIVVE--EPEFTEYIENVTVPAGRNVKLGC---------------SVKN 138
                         :.|.::|.  .|:..:...::...||..:...|               :...
 Worm   120 -------------AKLTVLVRPTPPKIVKSHHSLKAIAGDPITQSCLSRKGKPPPTIGWAIASDE 171

  Fly   139 LGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRG----RYMCQ 199
            .|.:.|:|:...:|....:|     ..|.||        ..|...|:|...:.:.|    |....
 Worm   172 HGKHIVSWLGESRSKFGGIH-----AKPEIS--------QETVIAHVNETTQVEEGGNNSREDSS 223

  Fly   200 INTVTAKTQF--------GYL-----NVVVPPNID-DSLS-------------SSDVIVREGANI 237
            |.::.:...|        .||     ::..|..|: ||:.             :|.:.:||..:.
 Worm   224 IYSIMSNLSFIPRPEDDHKYLICISQHMTFPNKIEVDSVKLSLRYAPQINLTVASKLPLRENGSA 288

  Fly   238 SLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGA-YLCIASNGVPPT 301
            .|.|..:..|.        ||.:|:..|.:......||||....:...|... ..|.|:|.: .|
 Worm   289 LLACNVNAKPL--------DNVKISWYKGNQKLRETGDTLTFETLKMEDHNRDIFCEATNEI-GT 344

  Fly   302 VSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPII--HDSHKYKVE 364
            ....||::|.|...::...|.....||.|....|.|.|:|....:||||:...|  |..:     
 Worm   345 TRGSIKLNVAFGARIMSTSQDKEVNEGDNAFFHCATLANPAPAIFWTRGDSDEIIGHGEN----- 404

  Fly   365 ATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIR--LYVSYPPTTAS--------- 418
                         ||:.||.:...|.|.|.| ...|....|:.  |::..|||.:.         
 Worm   405 -------------LTLENVRTWQQGNYNCTA-TVEGFRKQILSHYLHIRGPPTVSMKDEVSASLD 455

  Fly   419 ---------SGIYST-DTHWGENG--INNN------YAYGGPDSTRSIY------AQDKNTRYQS 459
                     ||...| :..|..||  ||.|      :.|..|....||.      .:|......|
 Worm   456 EATEIICEISGRPKTNNVRWTVNGKEINFNNGRITVHQYPKPYGKESILKIKDLKEEDFGVYNCS 520

  Fly   460 NLNEIGLSEQKSFLDK 475
            ..|.:|...:.:.|.|
 Worm   521 ANNGLGFDNRGTLLKK 536

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/128 (16%)
Ig 130..200 CDD:143165 14/89 (16%)
I-set 226..310 CDD:254352 21/85 (25%)
IGc2 233..298 CDD:197706 16/66 (24%)
Ig 313..410 CDD:299845 25/101 (25%)
IG_like 325..410 CDD:214653 24/89 (27%)
syg-1NP_001123159.1 I-set 24..124 CDD:254352 15/82 (18%)
Ig 30..124 CDD:299845 15/82 (18%)
Ig <151..265 CDD:299845 22/127 (17%)
Ig_2 276..353 CDD:290606 21/86 (24%)
IG_like 283..353 CDD:214653 20/79 (25%)
IG_like 363..427 CDD:214653 23/83 (28%)
Ig_2 368..438 CDD:290606 24/89 (27%)
Ig 440..528 CDD:299845 20/88 (23%)
IG_like 450..535 CDD:214653 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.