DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and C53A5.13

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001256598.1 Gene:C53A5.13 WormBaseID:WBGene00008270 Length:681 Species:Caenorhabditis elegans

Alignment Length:503 Identity:99/504 (20%)
Similarity:145/504 (29%) Gaps:199/504 (39%)


  Fly    80 SGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNV----KLGCSVKNLG 140
            ||..||  ....:.|.     :|.:.|.|...:|. |.|  ||||.||.:.    |:.|:...|.
 Worm   173 SGNSST--NKRSITVP-----IPLTRLQIDGLKPA-TAY--NVTVQAGTSYGYGNKVWCAFATLD 227

  Fly   141 S-------------------YKVAWM----------------------HFEQSAI---LTVHNHV 161
            |                   :...|:                      ..|.|||   ...|..|
 Worm   228 SDEANILKLRSRTPNSLTVYWPANWLTKTTSKFTIKAKTIHSPTGVSKEIENSAIGEPGKAHEFV 292

  Fly   162 I-------TRNPRISVTHD--------------KHDRHRTWYLHINNVHEEDRGRYMCQINTVTA 205
            :       |.|..|:.:.|              ||.    |.:    .....:|.|......:..
 Worm   293 VDNLLPSSTYNITITTSDDQLKNGGKKWTQMRWKHG----WAV----FSTMSQGEYGVAEARIVV 349

  Fly   206 KTQFGYLNVVVPP------NIDDSLS------SSDVIVREGANISLRCRASGSPRPIIKWK---- 254
            :|.|. :::|..|      ||...:.      :|..|..|..:.:|:|     |:...:||    
 Worm   350 ETDFA-VSIVFQPLKLAGRNITYQIKYTLKDRNSSQITNELTDSNLKC-----PKFECQWKCALI 408

  Fly   255 -------RDDNSRIAINKNHIVNEWEGDTLE----ITRISRL--------DMGAY-----LCIAS 295
                   |:....|....:::.|.|...||.    :.|:..:        .:|.|     :.:.|
 Worm   409 FNLPHRPREYKFEIRAKVDNVWNRWSPVTLRQWNLLERVCSIHPPSDLVGHLGDYTRQRDIDVQS 473

  Fly   296 NGVPPTVSK-RIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSH 359
            ..||..... |..|.||..|..|.|..:                   |.|...|..|.    |..
 Worm   474 AKVPQIADVWRYMVVVDSRPYDLAPIDI-------------------TKLADRTTSEA----DHV 515

  Fly   360 KYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYST 424
            .|.:.|.:.....|.|....|     ||..||           .|    |::||..|      ..
 Worm   516 PYYITAALTPEEVKNHGDFRI-----GDGKIY-----------GG----YLNYPLRT------EI 554

  Fly   425 DTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKSF 472
            |..|                |.....|.:|...:.:|...|.:||.:|
 Worm   555 DPRW----------------TLIPVTQSENEMIEPHLKTCGFNEQGTF 586

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 29/165 (18%)
Ig 130..200 CDD:143165 20/139 (14%)
I-set 226..310 CDD:254352 22/113 (19%)
IGc2 233..298 CDD:197706 16/93 (17%)
Ig 313..410 CDD:299845 19/97 (20%)
IG_like 325..410 CDD:214653 16/85 (19%)
C53A5.13NP_001256598.1 fn3 130..216 CDD:278470 17/53 (32%)
FN3 234..308 CDD:304408 10/74 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.