DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Ncam2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 MGIID:97282 Length:837 Species:Mus musculus

Alignment Length:477 Identity:114/478 (24%)
Similarity:180/478 (38%) Gaps:110/478 (23%)


  Fly     5 SWHLIGALL-----VLAATAGDSTNKIILPQILNGGGGGGGVG-------TAQGK-------HPS 50
            |::|:|.|:     :|..|.  |.:|:.|           .||       ||.|:       :|.
Mouse     6 SFYLLGLLVRSGQALLQVTI--SLSKVEL-----------SVGESKFFTCTAIGEPESIDWYNPQ 57

  Fly    51 GSKTVATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGG-------GANVPTSNLNI 108
            |.|.::|..|               .:...|..|.:...|..|...|       .|...|....:
Mouse    58 GEKIISTQRV---------------MLQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATV 107

  Fly   109 VVE---EPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNP--RI 168
            |:|   :..|.|.:.......|.:.::.|.|.:..:..|:|::         ||..:|..|  |.
Mouse   108 VLEIYQKLTFREVVSPQEFKQGEDAEVVCRVSSSPAPAVSWLY---------HNEEVTTIPDNRF 163

  Fly   169 SVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVV----VPPNIDDSLSSSDV 229
            :|..:.:       |.|.|:::.|.|.|.|: ..|.|:.:..:.:::    |||.|.....|.:.
Mouse   164 AVLANNN-------LQILNINKSDEGIYRCE-GRVEARGEIDFRDIIVIVNVPPAIMMPQKSFNA 220

  Fly   230 IVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEIT--RISRLDMGAYLC 292
            ....|..::|.|:|||||.|.|.|.| :...|..|:.:|:   :|...|:|  .|...|.|:|:|
Mouse   221 TAERGEEMTLTCKASGSPDPTISWFR-NGKLIEENEKYIL---KGSNTELTVRNIINKDGGSYVC 281

  Fly   293 IASNGVPPTVSKRIKVSVD----FPPMLLIPH--QLVG--APEGFNVTIECFTEAHPTSLNYWTR 349
            .|:|          |...|    |..:.:.||  ||..  ..|..:||:.|..|..|.....|.|
Mouse   282 KATN----------KAGEDQKQAFLQVFVQPHILQLKNETTSENGHVTLVCEAEGEPVPEITWKR 336

  Fly   350 GEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPP 414
            ....::........:..:.:........|.|.:|...|.|.|.|.|.:..|.....:.|.:.|.|
Mouse   337 AIDGVMFSEGDKSPDGRIEVKGQHGRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEYAP 401

  Fly   415 TTASSG--IYSTDTHWGENGIN 434
            ...|:.  .||    |..|.||
Mouse   402 KFVSNQTMYYS----WEGNPIN 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/102 (20%)
Ig 130..200 CDD:143165 17/72 (24%)
I-set 226..310 CDD:254352 27/86 (31%)
IGc2 233..298 CDD:197706 25/67 (37%)
Ig 313..410 CDD:299845 22/101 (22%)
IG_like 325..410 CDD:214653 18/85 (21%)
Ncam2NP_001106679.1 Ig1_NCAM-2 21..112 CDD:143274 24/119 (20%)
I-set 22..111 CDD:254352 23/117 (20%)
I-set 117..193 CDD:254352 22/93 (24%)
IGc2 128..189 CDD:197706 18/78 (23%)
Ig 208..301 CDD:299845 32/107 (30%)
I-set 215..298 CDD:254352 29/97 (30%)
Ig 300..397 CDD:299845 22/97 (23%)
IG_like 308..395 CDD:214653 17/87 (20%)
IG_like 413..491 CDD:214653 4/8 (50%)
IGc2 414..482 CDD:197706 3/7 (43%)
FN3 496..588 CDD:238020
fn3 594..678 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.