DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and rig-4

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_501339.2 Gene:rig-4 WormBaseID:WBGene00004371 Length:2325 Species:Caenorhabditis elegans

Alignment Length:328 Identity:71/329 (22%)
Similarity:110/329 (33%) Gaps:141/329 (43%)


  Fly   192 DRGRYMCQI-NTVTAKTQFGYLNVVVPPN------IDDSLSSSDVIVRE-----GANISLRCRAS 244
            |..:|.|.. |||.|        .:.||:      :||..:|.:.:..|     |....||    
 Worm    88 DEKKYRCVARNTVGA--------AISPPSMVRSKYLDDFDASDESVQYEVTTGVGRYFVLR---- 140

  Fly   245 GSPRPII----------KWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIAS---- 295
               ||.:          .|.:||:.::..:..|.|.. :|: |.:|.:.|.|.|||..:||    
 Worm   141 ---RPTLLASRNLDISYSWIKDDSHQVTPDATHFVTS-DGN-LVVTGVKRDDFGAYKLMASSDDL 200

  Fly   296 ------------NGVPPTVSKRIKVSVDFPPMLLI-----PH----------------------- 320
                        ||:.|::...:.: |.||....|     ||                       
 Worm   201 KEIVSKEYNVRDNGLSPSLQNTLSI-VYFPTDRTIIESTLPHDEIFDCVTSFGSKDDVRIRWFLN 264

  Fly   321 --QLVGAPEGFNVTI--ECFTEAHPTSLNYWTRGE--------------------------GPII 355
              |:.|:..|...|:  .....::|:|   :||||                          .||:
 Worm   265 GQQISGSEVGMTTTLNNRRLIISNPSS---FTRGEHKLECRADAAMGRTSDQKSAYMTFISRPIL 326

  Fly   356 HDSHKYKVEATVG----------------LPAYKTHM-------KLTIINVSSGDDGIYKCVAKN 397
            .|... :::.|||                :..||..:       ||||..:...|.|:|:|.|.|
 Worm   327 KDLPN-EIQKTVGSSLSLKCSVKKKSSMDIKWYKNGLMMTTQRGKLTIDRIKQDDFGLYQCEATN 390

  Fly   398 PRG 400
            ..|
 Worm   391 AAG 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 7/25 (28%)
Ig 130..200 CDD:143165 3/8 (38%)
I-set 226..310 CDD:254352 25/115 (22%)
IGc2 233..298 CDD:197706 23/96 (24%)
Ig 313..410 CDD:299845 33/170 (19%)
IG_like 325..410 CDD:214653 27/128 (21%)
rig-4NP_501339.2 IG_like 330..402 CDD:214653 16/66 (24%)
IGc2 338..393 CDD:197706 13/55 (24%)
I-set 459..543 CDD:254352
IGc2 478..534 CDD:197706
IG_like 553..639 CDD:214653
Ig 564..635 CDD:143165
FN3 643..747 CDD:238020
FN3 756..850 CDD:238020
FN3 858..954 CDD:238020
FN3 959..1042 CDD:238020
FN3 1057..1151 CDD:238020
FN3 1156..1251 CDD:238020
FN3 1258..1356 CDD:238020
FN3 1361..1453 CDD:238020
FN3 1464..1560 CDD:238020
FN3 1572..1664 CDD:238020
FN3 1679..1764 CDD:238020
FN3 1774..1858 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.