DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and lad-2

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001023496.1 Gene:lad-2 / 177078 WormBaseID:WBGene00002243 Length:1187 Species:Caenorhabditis elegans


Alignment Length:313 Identity:77/313 - (24%)
Similarity:132/313 - (42%) Gaps:65/313 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 IENVTVPAGRNVKLGCS-VKNLGSYKVAWMH---FEQSAILTVHNHVITRNPRISVTHDKHDRHR 179
            ::.:.|..|.::.|.|: .:.....|:.|::   .:.|.|.|:      |:..|:|.::.|    
 Worm   133 VKLLRVKEGESLTLNCTPPRGTPDPKIVWLYRSLDDSSVIETI------RSRHITVDNEGH---- 187

  Fly   180 TWYLHINNVHEEDRGR----YMCQINTVTAKTQF---GYLNVVVPPNIDD-------SLSSSDVI 230
               ||.::|...| |:    |.|...:...:.::   ..:.:.:.|:.|.       |:|.|:|.
 Worm   188 ---LHFSSVELSD-GKATLVYECAATSPVLRGEYRSGDRIQLDIEPSQDKSHPVKKMSVSPSEVT 248

  Fly   231 VREGANISLRCRASGSPRPIIKWKRDD----NSRIAINKNHIVNEWEGD---TLEITRISRLDMG 288
            ||.|..:.|:|...|.|.|.|.|.:.|    .|||....:|     |.|   :|.:..:...|.|
 Worm   249 VRAGGQLKLQCIFGGRPLPTIFWSKIDGELPKSRIKDLTSH-----ESDFGRSLIVENVHPDDAG 308

  Fly   289 AYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGP 353
            ||.|...:.| .||:.|:..:   |.....|.:.:..||.....:||.....||.:..|:. .|.
 Worm   309 AYECRGRHLV-HTVNVRVMAA---PFWEFDPPRDISLPEESTGELECLAGGQPTPIITWSM-NGK 368

  Fly   354 IIH----DSHKYKVEATVGLPAYKTHMK-LTIINVSSG-DDGIYKCVAKNPRG 400
            .:|    ||.:..::          |.: |.:.|::.. |.|:|:|.|.||.|
 Worm   369 FLHELAEDSRRVLLD----------HGRILRVRNLNHDLDTGVYQCNASNPLG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/106 (19%)
Ig strand B 130..134 CDD:409405 1/3 (33%)
Ig strand C 143..147 CDD:409405 1/3 (33%)
Ig strand E 178..185 CDD:409405 1/6 (17%)
IgI_1_MuSK 218..310 CDD:409562 33/105 (31%)
Ig strand A 218..221 CDD:409562 1/2 (50%)
Ig strand A' 226..231 CDD:409562 2/4 (50%)
Ig strand B 237..244 CDD:409562 2/6 (33%)
Ig strand C 250..255 CDD:409562 2/4 (50%)
Ig strand C' 257..259 CDD:409562 1/5 (20%)
Ig strand D 267..270 CDD:409562 1/2 (50%)
Ig strand E 275..281 CDD:409562 2/8 (25%)
Ig strand F 288..295 CDD:409562 4/6 (67%)
Ig strand G 302..310 CDD:409562 2/7 (29%)
IG_like 325..410 CDD:214653 22/82 (27%)
Ig strand B 331..335 CDD:143207 0/3 (0%)
Ig strand C 344..348 CDD:143207 0/3 (0%)
Ig strand E 376..380 CDD:143207 1/4 (25%)
Ig strand F 390..395 CDD:143207 2/4 (50%)
Ig strand G 403..406 CDD:143207
lad-2NP_001023496.1 Ig 25..121 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 61..65 CDD:409353
Ig strand E 87..91 CDD:409353
Ig strand F 101..106 CDD:409353
Ig strand G 115..118 CDD:409353
Ig 133..216 CDD:472250 20/96 (21%)
Ig strand B 144..148 CDD:409353 1/3 (33%)
Ig strand C 158..162 CDD:409353 1/3 (33%)
Ig strand E 186..190 CDD:409353 2/10 (20%)
Ig strand F 203..208 CDD:409353 2/4 (50%)
Ig 243..325 CDD:472250 29/87 (33%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 1/3 (33%)
Ig strand E 295..299 CDD:409353 1/3 (33%)
Ig strand F 309..314 CDD:409353 3/4 (75%)
Ig4_L1-NrCAM_like 330..422 CDD:409367 23/93 (25%)
Ig strand B 347..351 CDD:409367 0/3 (0%)
Ig strand C 360..364 CDD:409367 0/3 (0%)
Ig strand E 386..390 CDD:409367 1/3 (33%)
Ig strand F 401..406 CDD:409367 2/4 (50%)
Ig strand G 414..417 CDD:409367
IG_like 438..515 CDD:214653
Ig strand B 444..448 CDD:409353
Ig strand C 457..461 CDD:409353
Ig strand E 482..485 CDD:409353
Ig strand F 495..500 CDD:409353
Ig strand G 508..511 CDD:409353
Ig 527..593 CDD:472250
Ig strand B 538..542 CDD:409353
Ig strand C 551..557 CDD:409353
Ig strand E 574..578 CDD:409353
Ig strand F 588..593 CDD:409353
FN3 610..697 CDD:238020
FN3 <666..1095 CDD:442628
fn3 823..909 CDD:394996
FN3 921..1010 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.