DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and lad-2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001023496.1 Gene:lad-2 WormBaseID:WBGene00002243 Length:1187 Species:Caenorhabditis elegans

Alignment Length:313 Identity:77/314 (25%)
Similarity:132/314 (42%) Gaps:65/314 (21%)


  Fly   119 IENVTVPAGRNVKLGCS-VKNLGSYKVAWMH---FEQSAILTVHNHVITRNPRISVTHDKHDRHR 179
            ::.:.|..|.::.|.|: .:.....|:.|::   .:.|.|.|:      |:..|:|.::.|    
 Worm   133 VKLLRVKEGESLTLNCTPPRGTPDPKIVWLYRSLDDSSVIETI------RSRHITVDNEGH---- 187

  Fly   180 TWYLHINNVHEEDRGR----YMCQINTVTAKTQF---GYLNVVVPPNIDD-------SLSSSDVI 230
               ||.::|...| |:    |.|...:...:.::   ..:.:.:.|:.|.       |:|.|:|.
 Worm   188 ---LHFSSVELSD-GKATLVYECAATSPVLRGEYRSGDRIQLDIEPSQDKSHPVKKMSVSPSEVT 248

  Fly   231 VREGANISLRCRASGSPRPIIKWKRDD----NSRIAINKNHIVNEWEGD---TLEITRISRLDMG 288
            ||.|..:.|:|...|.|.|.|.|.:.|    .|||....:|     |.|   :|.:..:...|.|
 Worm   249 VRAGGQLKLQCIFGGRPLPTIFWSKIDGELPKSRIKDLTSH-----ESDFGRSLIVENVHPDDAG 308

  Fly   289 AYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGP 353
            ||.|...:.| .||:.|:..:   |.....|.:.:..||.....:||.....||.:..|:. .|.
 Worm   309 AYECRGRHLV-HTVNVRVMAA---PFWEFDPPRDISLPEESTGELECLAGGQPTPIITWSM-NGK 368

  Fly   354 IIH----DSHKYKVEATVGLPAYKTHMK-LTIINVSSG-DDGIYKCVAKNPRG 400
            .:|    ||.:..::          |.: |.:.|::.. |.|:|:|.|.||.|
 Worm   369 FLHELAEDSRRVLLD----------HGRILRVRNLNHDLDTGVYQCNASNPLG 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/107 (19%)
Ig 130..200 CDD:143165 18/78 (23%)
I-set 226..310 CDD:254352 29/91 (32%)
IGc2 233..298 CDD:197706 21/72 (29%)
Ig 313..410 CDD:299845 24/95 (25%)
IG_like 325..410 CDD:214653 22/83 (27%)
lad-2NP_001023496.1 IG_like 48..116 CDD:214653
Ig 49..121 CDD:299845
Ig 124..214 CDD:299845 20/95 (21%)
IG_like 244..325 CDD:214653 29/87 (33%)
Ig 255..325 CDD:299845 24/76 (32%)
I-set 335..421 CDD:254352 23/89 (26%)
Ig4_L1-NrCAM_like 344..422 CDD:143179 20/80 (25%)
IG_like 438..515 CDD:214653
Ig 443..516 CDD:299845
IG_like 527..608 CDD:214653
Ig 535..>593 CDD:299845
FN3 610..697 CDD:238020
FN3 721..804 CDD:238020
fn3 823..909 CDD:278470
FN3 921..1010 CDD:238020
FN3 1016..1108 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.