DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and let-805

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001022641.1 Gene:let-805 WormBaseID:WBGene00002915 Length:4450 Species:Caenorhabditis elegans

Alignment Length:469 Identity:86/470 (18%)
Similarity:151/470 (32%) Gaps:128/470 (27%)


  Fly    99 ANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSA------ILTV 157
            |..|:::.:::.:.|.           |..||:|....:.|  .:.||...::|.      .:|.
 Worm   764 ATSPSASFSVLCQVPS-----------APENVRLERVSEQL--VRAAWDSSQESGDCQSYFFITG 815

  Fly   158 HNHVITRNPRISVTHDKHD----RHRTWYLHINNVHEEDRG-------------------RYMCQ 199
            ..:....|.|:..:....|    ....|.:.:..|:....|                   |.:|.
 Worm   816 QQNGQAINQRVPGSDRSVDIAGSSQGDWRVQVRGVNTAGSGTPSRDAIFASSAQQSRRSKRSVCD 880

  Fly   200 INT-VTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAI 263
            ..| ...|.:|.. :.:..|:..::|.|:..::.:..::            |:|||.:.:.| .:
 Worm   881 PRTDFWCKGEFSN-SPLREPDSGEALCSTPRVLAQENDL------------IVKWKSEGDGR-GV 931

  Fly   264 NKNHIV--NEWEG------------DTLEITR--------------ISRLDMGAYLCIASNGVPP 300
            ...|:.  ||..|            |.:|.|:              :..||..:|:...|     
 Worm   932 YGYHVQFRNENSGWKTYGQLVPYVRDNMEYTQTLTGLERGHAYFIHVQVLDRNSYVMYTS----- 991

  Fly   301 TVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYW-------------TRGEG 352
             .....|.|.. ||.....|..|.||:..:|.::.......|    |             .||:.
 Worm   992 -AQSSAKSSCS-PPTHTPSHLQVAAPDASHVRVQWALPPQST----WGCSDIQFEIQPEEPRGQP 1050

  Fly   353 PIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTA 417
            .::..||:.. ......|.....:|:..||.:...........|.|.| .:.||...|||   ..
 Worm  1051 AVVLGSHQTS-HIFNSAPNQMWSVKIRAINSAGHSAWTPAAQTKTPPG-GELIIGPDVSY---RQ 1110

  Fly   418 SSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKN--------TRYQSNLNEI--GLSEQKSF 472
            ...|.|..:....|.:..::......:|.|.:.|.:|        ..|..:|.|:  |.:.|...
 Worm  1111 GKPIISWRSKENTNDLIESFVLEWKSTTESSWRQHRNPIPYNGWQRPYSVDLGELPQGHTYQVRI 1175

  Fly   473 LDKTQNPLLANGNA 486
            :.|..|    .|||
 Worm  1176 VAKDPN----RGNA 1185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/126 (16%)
Ig 130..200 CDD:143165 15/99 (15%)
I-set 226..310 CDD:254352 19/112 (17%)
IGc2 233..298 CDD:197706 16/93 (17%)
Ig 313..410 CDD:299845 22/110 (20%)
IG_like 325..410 CDD:214653 18/98 (18%)
let-805NP_001022641.1 fn3 30..110 CDD:278470
fn3 143..212 CDD:278470
fn3 241..310 CDD:278470
FN3 438..530 CDD:238020
FN3 1007..1094 CDD:238020 16/92 (17%)
FN3 1115..1195 CDD:238020 16/76 (21%)
FN3 1205..1293 CDD:238020
fn3 1299..1386 CDD:278470
FN3 1400..1493 CDD:238020
FN3 1502..1613 CDD:238020
fn3 1629..1696 CDD:278470
FN3 1720..1808 CDD:238020
FN3 1815..1905 CDD:238020
FN3 1910..1997 CDD:238020
FN3 2017..2100 CDD:214495
FN3 2116..2219 CDD:238020
FN3 2224..2307 CDD:214495
FN3 2322..2420 CDD:238020
fn3 2427..2510 CDD:278470
FN3 2522..2617 CDD:238020
FN3 2624..2715 CDD:238020
FN3 2720..2823 CDD:238020
FN3 2833..2929 CDD:238020
FN3 2937..3011 CDD:214495
FN3 3040..3129 CDD:238020
FN3 3145..3237 CDD:238020
FN3 3243..3350 CDD:238020
fn3 3368..3436 CDD:278470
fn3 3460..3550 CDD:278470
fn3 3567..3639 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.