DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and rig-5

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans

Alignment Length:380 Identity:120/381 (31%)
Similarity:181/381 (48%) Gaps:43/381 (11%)


  Fly   110 VEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQ-SAILTVHNHVITR------NPR 167
            :::|..:..:..:    |::|...|.|.:|||:.||::..:. ..:|:....|..|      .||
 Worm    86 IQQPSMSSAVALL----GQDVDFTCIVNDLGSHMVAFVKADSPPRLLSFDEKVFRRRNKYELKPR 146

  Fly   168 ISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVR 232
            |.      |.|..|.|.|.||.|.|||.|.|||||.......|.|:|.|||.:..|..:: |.||
 Worm   147 IG------DLHNEWVLTIKNVQESDRGNYSCQINTEPITLSTGELDVKVPPVVSRSTPAA-VEVR 204

  Fly   233 EGANISLRCRASGSPRPIIKWKRDDNSRIAIN--KNHIVNEWEGDTLEITRISRLDMGAYLCIAS 295
            ||.|:||.|:|.|:|.|.:.|:|.|...|..|  .....:.:.|..|.:|::||..|..|||:||
 Worm   205 EGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGPVLHLTKVSRKHMSEYLCVAS 269

  Fly   296 NGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHK 360
            ||:||..|..:|:.|.|||::....:.|.|..|....:.|.|||.|.....|.: :|..:::|:.
 Worm   270 NGIPPDESWTVKLLVTFPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEK-DGEPVYESNN 333

  Fly   361 YKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTD 425
            ..:..||....:..|: |.|.||.|...|:|:|||||..|         :.:...|.:...::..
 Worm   334 VAMTHTVSGQYHSVHI-LEIRNVQSSHFGVYRCVAKNDNG---------IHHSQVTLNQISHNHF 388

  Fly   426 THWGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNL-NEIGLSEQKSFLDKTQNP 479
            |       |:|....|....|.....|:....:.|| |:...||:    :.:|:|
 Worm   389 T-------NSNLIPEGSGMPRGYSEDDEADEEEDNLENQKNDSEE----EDSQSP 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 35/103 (34%)
Ig 130..200 CDD:143165 28/77 (36%)
I-set 226..310 CDD:254352 35/86 (41%)
IGc2 233..298 CDD:197706 28/67 (42%)
Ig 313..410 CDD:299845 29/97 (30%)
IG_like 325..410 CDD:214653 26/85 (31%)
rig-5NP_001251131.1 Ig 88..178 CDD:299845 33/100 (33%)
IG_like 92..189 CDD:214653 35/107 (33%)
IG_like 198..284 CDD:214653 35/87 (40%)
IGc2 205..270 CDD:197706 26/65 (40%)
IG_like 294..380 CDD:214653 28/97 (29%)
Ig 305..379 CDD:143165 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I2478
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T374792
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.