DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Papln

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001192272.1 Gene:Papln MGIID:2386139 Length:1302 Species:Mus musculus

Alignment Length:482 Identity:98/483 (20%)
Similarity:146/483 (30%) Gaps:152/483 (31%)


  Fly     4 PSWHLIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGS-----KTVATGVVPNF 63
            |.||..||               .:|::               ..||||     :..|.|..|:.
Mouse   855 PDWHRAGA---------------TIPRL---------------PSPSGSPWRREQEPAPGEPPHI 889

  Fly    64 GGAAGNGAGGGGPVAGSGTGSTVVG-SNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAG 127
             .|.||..|      |......|.| ......|....:.|:..:.:...||..      |....|
Mouse   890 -PAYGNRPG------GQEIRPRVPGLDREARPAVPPTHSPSYRIRLAGSEPSL------VQAAPG 941

  Fly   128 RNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEED 192
            :.|:|.|.......::..|.                :..| .::.:::.......|.|:.:..||
Mouse   942 QAVQLFCPGNIPSEFQAGWQ----------------KEGR-PISSNRYQLQADGSLIISRLRPED 989

  Fly   193 RGRYMCQINTVTAKTQFGYLNVV----------------VPPNID-------------------- 221
            .|.|.|..:....:.|...|.|.                .|.|.|                    
Mouse   990 AGIYSCGSHRPGHEPQEIQLRVTGGDMAVFPEGQPRHFPEPRNPDLGHGPPHRGTGAEAGGHRVL 1054

  Fly   222 -------------DSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWE 273
                         |......|....|..|.|.|||.|.|.|.|:|:||  .::..:..|.|.. :
Mouse  1055 SPSHPRPATRLRLDRTQPGVVDASPGQRIRLTCRAEGFPVPTIEWQRD--GQLVSSPRHQVQP-D 1116

  Fly   274 GDTLEITRISRLDMGAYLCIASNG-------VPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNV 331
            | :|.|:|:...|.|.|.|:|.||       |...|.:.:.:: ..||.:.:       .||...
Mouse  1117 G-SLVISRVDVEDGGYYSCVAFNGQDRDQRWVQLRVLRELTIT-GLPPAVTV-------AEGDTA 1172

  Fly   332 TIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMK----LTIINVSSGDDGIYK 392
            .:.|.......::. |:|...||..|.|             :.|..    |.|.|:...|:|.|.
Mouse  1173 RLLCVVAGESVNIR-WSRNGLPIQADGH-------------RVHQSPDGTLLIHNLRPRDEGSYT 1223

  Fly   393 CVAKNPRGETDGIIRLYVSYPPTTASS 419
            |.|............:.|:.|...|.|
Mouse  1224 CSAFRGSQAVSRSTEVKVALPAPAAQS 1250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 17/112 (15%)
Ig 130..200 CDD:143165 12/70 (17%)
I-set 226..310 CDD:254352 29/91 (32%)
IGc2 233..298 CDD:197706 26/72 (36%)
Ig 313..410 CDD:299845 20/101 (20%)
IG_like 325..410 CDD:214653 18/89 (20%)
PaplnNP_001192272.1 TSP1 30..81 CDD:214559
ADAM_spacer1 184..299 CDD:283607
TSP1 309..362 CDD:214559
TSP1 389..447 CDD:214559
TSP1 447..504 CDD:214559
TSP1 511..562 CDD:214559
Kunitz_BPTI 771..823 CDD:278443
Papilin_u7 831..922 CDD:293232 21/104 (20%)
Ig 932..>995 CDD:299845 15/86 (17%)
IG_like 1072..1151 CDD:214653 28/83 (34%)
IGc2 1079..1138 CDD:197706 24/63 (38%)
I-set 1157..1241 CDD:254352 20/106 (19%)
IGc2 1168..1226 CDD:197706 17/72 (24%)
PLAC 1257..1289 CDD:285849
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.