DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and IGSF5

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_011527774.1 Gene:IGSF5 / 150084 HGNCID:5952 Length:497 Species:Homo sapiens


Alignment Length:182 Identity:43/182 - (23%)
Similarity:67/182 - (36%) Gaps:42/182 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 AGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSY 142
            ||||:|                       |.|:|.|      :|..|..|...:..|:|..  .:
Human   123 AGSGSG-----------------------NEVIEGP------QNARVLKGSQARFNCTVSQ--GW 156

  Fly   143 KVAWMHFEQSAILTVH--NHVITRNPRISVTHDKHDR--HRTWYLHINNVHEEDRGRYMCQINTV 203
            |:.........:|:|.  ..:|| |.|.  |..::|:  :.|..:.|:||...|.|...|.:...
Human   157 KLIMWALSDMVVLSVRPMEPIIT-NDRF--TSQRYDQGGNFTSEMIIHNVEPSDSGNIRCSLQNS 218

  Fly   204 TAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPR-PIIKWK 254
            ..... .||.|.|...:  .:.|.:::|.|.....:.|..|...| |.|.|:
Human   219 RLHGS-AYLTVQVMGEL--FIPSVNLVVAENEPCEVTCLPSHWTRLPDISWE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/99 (24%)
Ig 130..200 CDD:143165 18/73 (25%)
I-set 226..310 CDD:254352 9/30 (30%)
IGc2 233..298 CDD:197706 7/23 (30%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
IGSF5XP_011527774.1 IG_like 135..228 CDD:214653 24/104 (23%)
Ig <200..230 CDD:299845 9/30 (30%)
Ig 236..307 CDD:299845 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.