DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Dscam

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_006522949.1 Gene:Dscam MGIID:1196281 Length:2034 Species:Mus musculus

Alignment Length:577 Identity:127/578 (22%)
Similarity:171/578 (30%) Gaps:177/578 (31%)


  Fly    74 GGPVAGSGTGSTVVGSNGV--IVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSV 136
            |..|:.....|:.|...||  ..|...|.|......|.|..|.....::|:|..|||:..:.|.|
Mouse   463 GNVVSYLNISSSQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRV 527

  Fly   137 KNLGSYKVAW-------------MHFEQSAILTVHN--------------------------HVI 162
            .....|.:.|             :.||.:..|.:.:                          ||.
Mouse   528 IGYPYYSIKWYKNANLLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVT 592

  Fly   163 TRNP----------------------------RISVTHDKHDR-------------HRTWYLHIN 186
            .:.|                            .|::|..|..|             ..|..|.|:
Mouse   593 VKVPPFIQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDGRPIPASLGVTIDNIDFTSSLRIS 657

  Fly   187 NVHEEDRGRYMC-QINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPI 250
            |:.....|.|.| ..|...|......|.|.|||.........|.|.  |..:.|.|.|.|.|.|.
Mouse   658 NLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRDQDGIY--GKAVILNCSAEGYPVPT 720

  Fly   251 IKWKRDD------------NSRIAINKN------HIVNEWEGDTLEITRISRLDMGAYLCIASNG 297
            |.||...            |.||.:..|      |:|.|              |.|.|||..||.
Mouse   721 IVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEE--------------DSGYYLCKVSND 771

  Fly   298 VPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYK 362
            |...|||.:.::|..|.|:........|.:|....:.|........:..|.:.:..|..:..:|.
Mouse   772 VGADVSKSMYLTVKIPAMITSYPNTTLATQGQRKEMSCTAHGEKPIIVRWEKEDRIINPEMARYL 836

  Fly   363 VEA-TVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTDT 426
            |.. .||.....|   |.|:.....|.|.:.|.|.|..||..|||:|.|..||......|.....
Mouse   837 VSTKEVGEEVIST---LQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPPEIEIKDVKA 898

  Fly   427 -----HWGENGINNNYAYGG----------------------------------PDSTRSI--YA 450
                 .| ..|.:.|....|                                  |.||.||  ||
Mouse   899 RTITLRW-TMGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRMYA 962

  Fly   451 QDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGARGHNPSMAIAW 507
            :          |.||.||..:.:..|.:....:|...|...|...::    |:.:.|
Mouse   963 K----------NRIGKSEPSNEITITADEAAPDGPPQEVHLEPTSSQ----SIRVTW 1005

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/177 (17%)
Ig 130..200 CDD:143165 21/151 (14%)
I-set 226..310 CDD:254352 30/102 (29%)
IGc2 233..298 CDD:197706 24/83 (29%)
Ig 313..410 CDD:299845 25/98 (26%)
IG_like 325..410 CDD:214653 23/86 (27%)
DscamXP_006522949.1 Ig 15..115 CDD:299845
IG 44..113 CDD:214652
IG_like 236..310 CDD:214653
IGc2 239..300 CDD:197706
IG_like 320..400 CDD:214653
IGc2 328..388 CDD:197706
IG_like 417..501 CDD:214653 10/38 (26%)
Ig 424..493 CDD:143165 9/30 (30%)
I-set 504..595 CDD:254352 15/91 (16%)
IGc2 518..575 CDD:197706 9/57 (16%)
I-set 596..686 CDD:254352 15/90 (17%)
IGc2 609..675 CDD:197706 12/66 (18%)
I-set 690..784 CDD:254352 31/110 (28%)
Ig7_DSCAM 707..784 CDD:143211 27/91 (30%)
IG_like 794..882 CDD:214653 23/91 (25%)
Ig 802..889 CDD:299845 25/90 (28%)
FN3 885..978 CDD:238020 19/104 (18%)
FN3 986..1083 CDD:238020 5/25 (20%)
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
IG_like 1302..1376 CDD:214653
IGc2 1302..1366 CDD:197706
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.