DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and ncam1b

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_005157462.1 Gene:ncam1b ZFINID:ZDB-GENE-010822-2 Length:1055 Species:Danio rerio

Alignment Length:512 Identity:109/513 (21%)
Similarity:171/513 (33%) Gaps:152/513 (30%)


  Fly    64 GGA--------AGNGAGGGGP----VAGSGTGSTVVGSNGVI--------VAGGGANVPTSNLNI 108
            |||        ||.....|.|    :....|.||:...|..:        ||..|.....:.:|:
Zfish    45 GGAKEIDWFAPAGEKIEPGRPDISVIRNDETSSTLTIYNAKVDNAGTYRCVASSGDQDAEATVNL 109

  Fly   109 ----------VVEEPEFTEYIENVTVPAGRNVKLGCSVKN------LGSYKVAWMHFEQSAILTV 157
                      |....||||         |.|..:.|.|.:      |..||.|.:.|        
Zfish   110 KIYQKITFTNVPSPQEFTE---------GDNAIIVCDVISSPPPTVLWKYKGAKIQF-------- 157

  Fly   158 HNHVITRNPRISVTHDKHDRHRTW---YLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPN 219
                           ||..|.:|.   :|.|..:.:.|.|.|.|: ..:.|:.:..:.::.|..|
Zfish   158 ---------------DKDVRFKTLSNNHLQIRGIRKTDEGVYTCE-GRIKARGEVDFRSIKVVVN 206

  Fly   220 IDDSL----SSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEIT 280
            :..::    :.::.....|.:..|.|...|.|.||:.|:| :|:.:.....:..|| :|..:.:.
Zfish   207 VLPTIRIRQAETNATADMGFSTLLACDPDGFPEPIVTWRR-NNAPLESGNKYSFNE-DGSEMTVL 269

  Fly   281 RISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLN 345
            .:::||.|.|.|||.|....: .:.:.:.|...|.:..............||:.|.....||...
Zfish   270 DVTKLDEGDYTCIAKNKAGES-EQELSLKVFVQPKITYLESQTTTEMDEQVTLTCEATGDPTPTI 333

  Fly   346 YW-------TRGE----------------------GPIIHDSHKYKVEATVGLPAYKTHMKLTII 381
            .|       |.||                      |.::..|.......|:..|.|.        
Zfish   334 TWSFGTRVFTEGEQEQQKRIYQASWTRPEQHKGPDGEVLVRSDARVSSLTLKYPQYT-------- 390

  Fly   382 NVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASS-GIYSTDTH------------------ 427
                 |.|.|.|.|:|..|||...:.|.|.|.|....| .:|:.:.:                  
Zfish   391 -----DAGQYLCTARNAIGETVQPVSLEVRYAPKILGSVAVYTWEGNPANISCEVLAHPSDVSIT 450

  Fly   428 WGENGI---NNNYAYGGPDSTRSIYAQDKNTRYQSNL--------NEIGLSEQKSFL 473
            |..:|.   |.|.:.....:|.|....:.|...||:.        |||| :|.:.|:
Zfish   451 WLRDGFQLPNANTSNIKIHNTPSASYLEVNPESQSDFGNYNCTTSNEIG-TESREFI 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/105 (19%)
Ig 130..200 CDD:143165 17/79 (22%)
I-set 226..310 CDD:254352 21/84 (25%)
IGc2 233..298 CDD:197706 21/65 (32%)
Ig 313..410 CDD:299845 25/126 (20%)
IG_like 325..410 CDD:214653 24/114 (21%)
ncam1bXP_005157462.1 Ig 20..112 CDD:299845 15/67 (22%)
I-set 21..111 CDD:254352 15/66 (23%)
IG_like 121..205 CDD:214653 25/117 (21%)
IGc2 128..189 CDD:197706 20/94 (21%)
Ig 208..301 CDD:299845 22/96 (23%)
I-set 212..298 CDD:254352 21/89 (24%)
I-set 298..414 CDD:254352 26/129 (20%)
Ig 300..414 CDD:299845 25/127 (20%)
IG_like 426..505 CDD:214653 15/80 (19%)
Ig 434..505 CDD:143165 14/72 (19%)
FN3 513..606 CDD:238020
FN3 629..720 CDD:238020
Chorion_3 <815..1019 CDD:253174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.