DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and ncam2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_571905.1 Gene:ncam2 ZFINID:ZDB-GENE-010822-1 Length:795 Species:Danio rerio

Alignment Length:440 Identity:99/441 (22%)
Similarity:166/441 (38%) Gaps:99/441 (22%)


  Fly    85 TVVGSNGVIVAG--GGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGS-YKVAW 146
            ||:...|::|.|  |...|..|              ::.|.:..|.:....|:|  :|. .|:.|
Zfish     4 TVLCFLGLLVGGSQGALQVSIS--------------LKKVELSVGESKFFTCTV--IGEPVKLEW 52

  Fly   147 MHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGY 211
            .:.:...::.        :||::: |::..|.|   |.:.|...||.|.|.||......:||   
Zfish    53 FNPQGERMVA--------SPRVAL-HNEGIRSR---LTLYNAKIEDAGIYRCQATDAQGETQ--- 102

  Fly   212 LNVVVPPNIDDSLSSSDV----IVREGANISLRCRASGSPRPIIKW------KRDDNSRIAINKN 266
             ...|...|...|:..||    ..|:|....:.|..:.||.|::.|      ..:|..:..:.:|
Zfish   103 -EATVVLEIYQKLTFRDVRSPQEFRQGEVAEVVCDVTSSPVPVVSWFYNNIEITEDTEKFELLQN 166

  Fly   267 HIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVS-KRIKVSVDFPPMLLIPHQLVGAPE--G 328
                    :.|::.::::.|.|.|.|.|.......:. :.|.:.|:.||::.:|.|...|..  |
Zfish   167 --------NNLQVQKVTKADEGVYRCEARVEARGEIDFRNIILVVNVPPVVSVPQQSFNATADYG 223

  Fly   329 FNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKC 393
            .:||..|.....|.....|.| :|..:.:|.:|.:.|        ....||:.|:...|.|.|.|
Zfish   224 ESVTFTCRAYGSPEPDVTWHR-KGVQLQESERYVMRA--------RGTTLTVRNIQQDDGGSYTC 279

  Fly   394 VAKNPRGETDGIIRLYVSYPP-------TTASSGIYS-----------TDTHWGENGINNNYAYG 440
            .|.|..||.:..:.|.|...|       .||..|..:           .:..|......::::.|
Zfish   280 RASNKAGEVEHELFLKVFVQPHITKLRNVTAVEGSAAMISCKAEGEPLPEISWRRASDGHSFSDG 344

  Fly   441 --GPD---STRSIYAQDKNT----------RYQSN-LNEIGLSEQKSFLD 474
              .||   ..|..|.:...|          |:... |:.||..::..|||
Zfish   345 DKSPDGRVEVRGRYGESMLTIVVVKLSDWGRFDCEALSRIGGHQKSMFLD 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/97 (23%)
Ig 130..200 CDD:143165 18/71 (25%)
I-set 226..310 CDD:254352 18/95 (19%)
IGc2 233..298 CDD:197706 14/71 (20%)
Ig 313..410 CDD:299845 28/99 (28%)
IG_like 325..410 CDD:214653 24/87 (28%)
ncam2NP_571905.1 Ig1_NCAM-2 20..111 CDD:143274 26/123 (21%)
I-set 21..110 CDD:254352 25/121 (21%)
IGc2 127..187 CDD:197706 14/68 (21%)
Ig 213..299 CDD:299845 26/95 (27%)
I-set 213..296 CDD:254352 25/92 (27%)
Ig 298..395 CDD:299845 18/98 (18%)
I-set 300..393 CDD:254352 16/93 (17%)
IG_like 411..488 CDD:214653
IGc2 412..480 CDD:197706
FN3 494..586 CDD:238020
fn3 <616..675 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.