DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and CHL1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_006605.2 Gene:CHL1 HGNCID:1939 Length:1224 Species:Homo sapiens

Alignment Length:329 Identity:82/330 (25%)
Similarity:126/330 (38%) Gaps:66/330 (20%)


  Fly   108 IVVEEPEF-TEYIENVTVPAGRNVKLGCS-VKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV 170
            ||...|:| .|.|:.:.|..|..:.|.|: .|.|....:.||:.|.       .| |.::.|:.:
Human   126 IVPSVPKFPKEKIDPLEVEEGDPIVLPCNPPKGLPPLHIYWMNIEL-------EH-IEQDERVYM 182

  Fly   171 THDKHDRHRTWYLHINNVHEED-RGRYMC-----QINTVTAK-------------------TQFG 210
            : .|.|      |:..||.|:| |..|.|     ::.|:..|                   |:.|
Human   183 S-QKGD------LYFANVEEKDSRNDYCCFAAFPRLRTIVQKMPMKLTVNSLKHANDSSSSTEIG 240

  Fly   211 YL---------NVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKN 266
            ..         .:::||.  :|.|.|.:.:.:|..:.|.|.|.|.|.|.:.|.:....   :.|.
Human   241 SKANSIKQRKPKLLLPPT--ESGSESSITILKGEILLLECFAEGLPTPQVDWNKIGGD---LPKG 300

  Fly   267 HIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNV 331
            ....|..|.||:|..:|..|.|.|.|.|||.: .|.:....|.|:.||......|......|.|.
Human   301 RETKENYGKTLKIENVSYQDKGNYRCTASNFL-GTATHDFHVIVEEPPRWTKKPQSAVYSTGSNG 364

  Fly   332 TIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAK 396
            .:.|..|..|.....|.....|:  |:|.:  ...|..|     .:::..|:......:|:|.|.
Human   365 ILLCEAEGEPQPTIKWRVNGSPV--DNHPF--AGDVVFP-----REISFTNLQPNHTAVYQCEAS 420

  Fly   397 NPRG 400
            |..|
Human   421 NVHG 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 26/131 (20%)
Ig 130..200 CDD:143165 20/77 (26%)
I-set 226..310 CDD:254352 25/84 (30%)
IGc2 233..298 CDD:197706 22/65 (34%)
Ig 313..410 CDD:299845 20/89 (22%)
IG_like 325..410 CDD:214653 17/77 (22%)
CHL1NP_006605.2 Ig 55..126 CDD:299845 82/330 (25%)
Ig2_L1-CAM_like 129..223 CDD:143253 28/109 (26%)
IG_like 140..224 CDD:214653 24/99 (24%)
IG_like 264..343 CDD:214653 25/83 (30%)
Ig3_L1-CAM_like 274..344 CDD:143208 24/74 (32%)
IG_like 353..434 CDD:214653 18/82 (22%)
Ig4_L1-NrCAM_like 361..435 CDD:143179 17/74 (23%)
IG_like 447..525 CDD:214653
Ig 457..525 CDD:299845
IG_like 548..624 CDD:214653
Ig 548..616 CDD:143165
DGEA 571..574
FN3 628..717 CDD:238020
fn3 731..811 CDD:278470
FN3 834..927 CDD:238020
FN3 932..1027 CDD:238020
Bravo_FIGEY 1120..1205 CDD:290593
FIG[AQ]Y 1197..1201
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.