DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and igsf5

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_002938783.2 Gene:igsf5 XenbaseID:XB-GENE-956741 Length:355 Species:Xenopus tropicalis

Alignment Length:388 Identity:76/389 (20%)
Similarity:132/389 (34%) Gaps:139/389 (36%)


  Fly   121 NVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTV---------HNHVITRNPRISVTHDKHD 176
            ||||.:|.:....|:|....| .:.|: ::...|:::         :.:::.:|...|:|.|   
 Frog    33 NVTVLSGSDATFQCTVAPTWS-AITWI-YQGVQIVSISPREVTVDPNQNIVVQNFTNSITRD--- 92

  Fly   177 RHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRC 241
              .|..:...||.:.:.||..|  .::::..|..:|:|.|..::|.:.:|..|.:....::|  |
 Frog    93 --FTSIVTFINVQKSNSGRIQC--FSLSSTNQEAFLSVQV
KGSLDIAKTSLSVTINTTVDVS--C 151

  Fly   242 RASG-SPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRIS-RLDMGAYLCIASNGVPPTVSK 304
            .|.| ||.||:.|              ::|.....:.|.|..| .:..|.|          .|:.
 Frog   152 GAVGWSPIPIMTW--------------VLNNTAASSSEYTTTSTEIQGGLY----------NVNS 192

  Fly   305 RIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATV-- 367
            .:|::                |.| |..:.|......|..|               ..|..||  
 Frog   193 ILKLT----------------PLG-NTRVTCIARIETTQQN---------------STVNITVTA 225

  Fly   368 -GLPAYKTHMKLTIINVSSGDDG-----------IYKCVAKNPRGETDGIIRLYVSYPPTTASSG 420
             ...|..|:.:.|:|...:...|           :..|..|..:.|        :||..|.    
 Frog   226 AAAAASSTYDRTTVIIAVTVTLGCILLIVLIIVVVVCCCRKEKQRE--------MSYQSTA---- 278

  Fly   421 IYSTDTHWG---ENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKSFLDKTQNPL 480
                   ||   :|.|...|             :|.|..|:.:::|:            |.||
 Frog   279 -------WGASAKNSIEQTY-------------KDYNFEYEPDISEV------------QRPL 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 23/104 (22%)
Ig 130..200 CDD:143165 15/79 (19%)
I-set 226..310 CDD:254352 19/86 (22%)
IGc2 233..298 CDD:197706 15/67 (22%)
Ig 313..410 CDD:299845 17/111 (15%)
IG_like 325..410 CDD:214653 17/99 (17%)
igsf5XP_002938783.2 Ig 23..>73 CDD:299845 10/42 (24%)
IG_like 31..128 CDD:214653 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80779870
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.