DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and lrit3

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_002934296.1 Gene:lrit3 XenbaseID:XB-GENE-6076513 Length:652 Species:Xenopus tropicalis

Alignment Length:397 Identity:84/398 (21%)
Similarity:142/398 (36%) Gaps:102/398 (26%)


  Fly    81 GTGSTVVGSNGVIVAGGGANVPTSNLNIVVEE-------PEFTEYIEN-----VTVPAGRNVKLG 133
            ||||..|..|...:.....|||...:.:.:|:       .|...|:.:     ||..        
 Frog    35 GTGSRSVLCNDPDMFDIPVNVPVDTVKLRIEKTVIRKIPTEAFYYLVDLKYLWVTYN-------- 91

  Fly   134 CSVKNLGS---YKVAWMH---FEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHE-- 190
             |:.::.|   |.:..:|   .:.:||.......:...|.:          ||..||.|.:..  
 Frog    92 -SISSIDSSSFYNLKQLHELRLDGNAISVFPWESLAEMPSL----------RTLDLHNNKIASIP 145

  Fly   191 EDRGRYMCQINTVTAKTQFGYLNV--------------VVPPNIDDSLSSSDVIVREGANISLR- 240
            .:..||:..|.         ||::              :.||..|.||.|||:..:. ..:.|: 
 Frog   146 AESARYLRNIT---------YLDLSSNKLTTLPSDLLDIWPPFSDKSLISSDLSTQR-VILGLQD 200

  Fly   241 ------CRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVP 299
                  ||.|    .:|:..:..:..|....:.:|.... |||......|:::...:|:.    |
 Frog   201 NPWFCDCRIS----KLIELSKTTDPHITFLDSFVVCSGP-DTLAGFLFQRVELEQEMCLK----P 256

  Fly   300 PTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVE 364
            ..::...|::               :|.|.||.:.|....:||....|:|..    :.:..|.|.
 Frog   257 SVMTSATKIT---------------SPLGSNVLLRCDASGNPTPQLLWSRTN----NSAANYTVV 302

  Fly   365 ATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIR-LYVSYPPTTASSGIYSTDTHW 428
            ........:..: |::..:|..|.|.|:|.|||..|..:..|. :.|....|||||  :..|...
 Frog   303 QETPTDGVRWSI-LSMNGISYKDAGEYRCKAKNFAGVAEASITVIVVGVVTTTASS--HRFDRRL 364

  Fly   429 GENGINN 435
            |...::|
 Frog   365 GAEQMSN 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 19/123 (15%)
Ig 130..200 CDD:143165 14/78 (18%)
I-set 226..310 CDD:254352 17/91 (19%)
IGc2 233..298 CDD:197706 12/72 (17%)
Ig 313..410 CDD:299845 22/98 (22%)
IG_like 325..410 CDD:214653 22/86 (26%)
lrit3XP_002934296.1 leucine-rich repeat 59..82 CDD:275378 3/23 (13%)
leucine-rich repeat 83..106 CDD:275378 5/32 (16%)
LRR_8 105..165 CDD:290566 14/79 (18%)
LRR_RI <107..190 CDD:238064 22/102 (22%)
leucine-rich repeat 107..130 CDD:275378 4/23 (17%)
leucine-rich repeat 131..154 CDD:275378 7/33 (21%)
leucine-rich repeat 155..168 CDD:275378 3/22 (14%)
Ig 255..338 CDD:299845 23/107 (21%)
IG_like 265..342 CDD:214653 21/97 (22%)
FN3 455..518 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.