DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and ntm

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis

Alignment Length:329 Identity:107/330 (32%)
Similarity:165/330 (50%) Gaps:39/330 (12%)


  Fly    91 GVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAIL 155
            ||.|..|.|..|.:              ::||||..|.:..|.|:|.|..: :|||::  :|.||
 Frog    29 GVPVRSGDAGFPKA--------------MDNVTVRQGDSAILRCTVDNRVT-RVAWLN--RSTIL 76

  Fly   156 TVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVT-AKTQFGYLNVVVPPN 219
            ...|...:.:||:.:..:...::.   :.|.||...|.|.|.|.:.|.. .||...:|.|.|||.
 Frog    77 YTGNDKWSIDPRVVLLANTKSQYS---IEIQNVDIYDEGPYTCSVQTDNHPKTSRVHLIVQVPPR 138

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISR 284
            |.|  .||.:.|.||:|:||.|.|:|.|.|::.|:     .::......|:  |.:.||||.|:|
 Frog   139 IVD--ISSSIAVNEGSNVSLICIANGRPEPVVNWR-----YLSPKARGFVS--EDEYLEITGITR 194

  Fly   285 LDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTR 349
            ...|.|.|.|||.|.....:|:|::|::||.:| ..|.:|||.|....::|...|.|.:..:|.:
 Frog   195 EQSGIYECSASNDVSAPDVRRVKLTVNYPPYIL-DAQNIGAPLGHRGILQCEASAVPAADFFWYK 258

  Fly   350 GEGPIIHDSHK-YKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYP 413
             |...:.||.: .|||..      :|..::|.:|||..|.|.|.|:|||..|.::..|.|:..:.
 Frog   259 -EDKRLSDSWRGVKVENR------ETISRVTFLNVSEQDYGNYTCMAKNLLGHSNASIILFELFQ 316

  Fly   414 PTTA 417
            .|::
 Frog   317 STSS 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/97 (31%)
Ig 130..200 CDD:143165 20/70 (29%)
I-set 226..310 CDD:254352 31/84 (37%)
IGc2 233..298 CDD:197706 25/65 (38%)
Ig 313..410 CDD:299845 33/98 (34%)
IG_like 325..410 CDD:214653 28/86 (33%)
ntmXP_004916061.1 Ig 45..133 CDD:299845 29/94 (31%)
IG_like 45..133 CDD:214653 29/94 (31%)
IG_like 143..220 CDD:214653 31/84 (37%)
IGc2 150..209 CDD:197706 26/66 (39%)
ig 227..311 CDD:278476 30/92 (33%)
IG_like 230..311 CDD:214653 29/88 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80529413
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41139
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.