DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dscaml1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_004916122.1 Gene:dscaml1 XenbaseID:XB-GENE-922538 Length:2043 Species:Xenopus tropicalis

Alignment Length:647 Identity:139/648 (21%)
Similarity:215/648 (33%) Gaps:181/648 (28%)


  Fly    11 ALLVLAATAGDSTNKII---LPQILNGGGGGGGVGTAQG-KHPSGSKTVATGVVPNFGGAAGN-- 69
            |::||.    |.|.:|:   ..:::|.|.....:.:|:| ..|:.:.|:....:....|...|  
 Frog   398 AIVVLE----DGTPRILSSFSEKVMNPGEQFSLMCSAKGAPPPTITWTLDDEPIQRDSGHRSNQY 458

  Fly    70 GAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTS--NLNIVVEEPEFTEYIENVTVPAGRNVKL 132
            ....|..|:.....|..:...||.......:|.::  ...|.|..|.....::|:|..|||:..:
 Frog   459 TTADGSTVSYMNVSSPQILDGGVYRCAARNSVGSAEYQARINVRGPPSIRPMKNLTAVAGRDSFI 523

  Fly   133 GCSVKNLGSYKVAWMHFEQSAIL-TVHNHVITRN------------------------PRISVTH 172
            .|.|.....|.::|  ::.|.:| ..|..|:..|                        |::|::.
 Frog   524 HCRVIGYPYYFISW--YKDSLLLPDNHRQVVFENGTLMLSDVQKGMDEGEYLCSVLIQPQLSISQ 586

  Fly   173 DKHDRHR----------------------------------TW---------------------- 181
            ..|...:                                  ||                      
 Frog   587 SVHVTVKVPPLIQPFEFPPASIGQLLYIPCVVSSGDMPIRITWRKDGQVIVSGSGITIETKEFMS 651

  Fly   182 YLHINNVHEEDRGRYMC----QINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCR 242
            .|.|::|..:..|.|.|    ...||:.:.|   |.|.|||......::.|.|.  |....|.|.
 Frog   652 SLQISSVSLKHNGNYTCIASNDAATVSRERQ---LIVRVPPRFVVQPNNQDGIY--GKAGVLNCS 711

  Fly   243 ASGSPRPIIKWKRDDNS-------------RIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIA 294
            ..|.|.|.:.||....|             ||.|..|        .:|.|..:...|:|.|||.|
 Frog   712 VDGYPPPKVVWKHAKGSGNPQQYHPVPLTGRIQILPN--------SSLLIRHVLEEDIGYYLCQA 768

  Fly   295 SNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSH 359
            ||||...:||.:.::|..|.|:........|.:|....:.|........:..|.:|:..|..|.:
 Frog   769 SNGVGTDISKSMFLTVKIPAMITSHPNTTIAIKGQTKGLNCTARGERPIIIRWEKGDTVIDPDRN 833

  Fly   360 KYKVEAT--VGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGI- 421
            ...:.||  .|.....|   ||:.....||...:.|.|.|..||..|:|:|.|..||......: 
 Frog   834 LRYLIATKDSGDEVIST---LTLKPAERGDSVFFSCHAINSYGEDRGLIQLTVQEPPDPPELEVR 895

  Fly   422 ----YSTDTHWGE----NGI---------NNNYAYGGPDSTRSIY-------------AQDKNTR 456
                .|.:..|.:    |.|         |.:.::....|||:|.             |...:.|
 Frog   896 EVKARSMNLRWTQRFDGNSIITAFDIEYKNKSDSWEFKQSTRNISPIINQANIVDLHPASVYSIR 960

  Fly   457 YQSNLNEIGLSEQKSFL--------------DKTQNPLLANG-----NANEADAESNGARGH 499
            ..| .|:||.||....|              |.|..||.:..     .|...:.::...||:
 Frog   961 MYS-FNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPLTSQSIQVTWKAPRKELQNGVIRGY 1021

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/181 (17%)
Ig 130..200 CDD:143165 20/155 (13%)
I-set 226..310 CDD:254352 29/97 (30%)
IGc2 233..298 CDD:197706 24/78 (31%)
Ig 313..410 CDD:299845 25/99 (25%)
IG_like 325..410 CDD:214653 23/87 (26%)
dscaml1XP_004916122.1 IG_like 42..118 CDD:214653
IGc2 42..109 CDD:197706
Ig 128..217 CDD:299845
I-set 232..310 CDD:254352
IGc2 239..300 CDD:197706
IGc2 327..388 CDD:197706
IG_like 328..388 CDD:214653
I-set 407..501 CDD:254352 16/94 (17%)
Ig 407..497 CDD:299845 15/90 (17%)
IG_like 511..592 CDD:214653 17/83 (20%)
IGc2 518..576 CDD:197706 11/60 (18%)
IG_like 606..685 CDD:214653 12/82 (15%)
Ig 614..680 CDD:143165 10/66 (15%)
I-set 689..784 CDD:254352 30/105 (29%)
Ig7_DSCAM 706..784 CDD:143211 26/86 (30%)
I-set 790..883 CDD:254352 23/96 (24%)
Ig 802..890 CDD:299845 25/91 (27%)
FN3 886..980 CDD:238020 20/95 (21%)
FN3 987..1084 CDD:238020 7/36 (19%)
fn3 1092..1178 CDD:278470
FN3 1190..1281 CDD:238020
IGc2 1305..1369 CDD:197706
FN3 1383..1473 CDD:238020
FN3 1487..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.