DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and papln

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_004917291.1 Gene:papln XenbaseID:XB-GENE-855687 Length:1198 Species:Xenopus tropicalis

Alignment Length:401 Identity:89/402 (22%)
Similarity:148/402 (37%) Gaps:118/402 (29%)


  Fly   120 ENVTVPAGRNVKLGCSVKNL-----GSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHR 179
            |:|.|...|:...| .||.|     |.:.....|.|.|.     :|:  ||..|:      :||:
 Frog   787 EDVPVEERRDHNQG-MVKTLDQDLEGRHLAGHSHGESST-----SHI--RNGDIT------ERHK 837

  Fly   180 TWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRAS 244
            |                  :.:|.|::....|..::      |.:..|.:....|....|.|:.|
 Frog   838 T------------------KTDTNTSQHSSVYSIIL------DKVKFSSMETIRGQTAHLPCQVS 878

  Fly   245 GSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVS 309
            ..|...|:|::|..:.:..:| :|.|. :| :|.|.|:...|.|.|.|:||:| ....|.|:::.
 Frog   879 DYPFSNIEWQKDGQALLPSSK-YIYNP-DG-SLVINRVHSEDAGEYKCLASSG-SRRESHRVRLQ 939

  Fly   310 V-DF-------------------PPMLLIPHQ----------LVGAPEGFNVTIECFTEAHPTSL 344
            | |.                   .|:    |.          ::.|..|....:.|..|.|.::.
 Frog   940 VKDLGAQGAQRVNASQATKDTRNQPL----HSDRRGSAKTPLVIDASLGHRTRLPCLLEVHSSTN 1000

  Fly   345 NYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIR-- 407
            ..|.:...|:....|:.:.:.:           |||..:|..|.|||.|.|....|:....|:  
 Frog  1001 VEWQKDGKPLSSPRHRKQSDGS-----------LTISRMSPDDAGIYTCTATTRAGQVVKYIQLN 1054

  Fly   408 ----LYVSYPPT--TASSGI----------YSTDTHWGENGI----NNNYAYGGPDST---RSIY 449
                |.::.|||  |.|.|.          .:.:..|..||:    :.::.:...|.|   |:..
 Frog  1055 IRGELKITGPPTSLTVSEGEKAELRCVVSGQNANIQWSRNGLPVRSDWHHTHVSEDGTLIIRNTK 1119

  Fly   450 AQDKNTRYQSN 460
            |.|:.: |..|
 Frog  1120 AADEGS-YTCN 1129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/101 (22%)
Ig 130..200 CDD:143165 15/75 (20%)
I-set 226..310 CDD:254352 25/84 (30%)
IGc2 233..298 CDD:197706 22/65 (34%)
Ig 313..410 CDD:299845 23/113 (20%)
IG_like 325..410 CDD:214653 21/91 (23%)
paplnXP_004917291.1 PLAC 1164..1196 CDD:285849
TSP1 30..81 CDD:214559
ADAM_spacer1 186..299 CDD:283607
TSP1 309..362 CDD:214559
TSP1 387..445 CDD:214559
TSP1 448..501 CDD:214559
TSP1 507..562 CDD:214559
Kunitz_BPTI 701..753 CDD:278443
I-set 861..940 CDD:254352 25/83 (30%)
Ig 871..937 CDD:143165 23/70 (33%)
IG_like 976..1055 CDD:214653 20/90 (22%)
IGc2 984..1045 CDD:197706 17/72 (24%)
I-set 1060..1141 CDD:254352 16/72 (22%)
Ig 1076..1145 CDD:299845 10/56 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.