DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and iglon5

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis

Alignment Length:323 Identity:97/324 (30%)
Similarity:152/324 (47%) Gaps:46/324 (14%)


  Fly   101 VPTSNLNIV-------VEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVH 158
            |..::|.||       |:..||....:|.||..|.|..|.|.:.:..: :|||::  :|.||...
 Frog     8 VSLASLGIVMLAQVLFVQCTEFVPPADNYTVSQGDNATLSCLIDDKVT-RVAWLN--RSNILYAG 69

  Fly   159 NHVITRNPRIS-VTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTV-TAKTQFGYLNVVVPPNID 221
            ....:.:.|:. :|:.|.:    :.:.|.:|...|.|.|.|...|. ...|...||.|.||..|.
 Frog    70 KDKWSIDSRVQLLTNTKSE----YSIVITHVDVADEGLYTCSFQTEDKPHTSQVYLIVQVPAKIV 130

  Fly   222 DSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEW---EGDTLEITRIS 283
            :  .||.|.|.||:|::|:|.|.|.|.|.|.|::             ::|.   ||:.||||.|:
 Frog   131 N--ISSSVTVNEGSNVNLQCLAVGKPEPTITWQQ-------------LSEGFSSEGELLEITEIN 180

  Fly   284 RLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWT 348
            |...|.|.|:.||||....:|:::::|::|| .:...:...:|.|...|:.|...|.|.:...|.
 Frog   181 RQQAGDYECVTSNGVSVPDTKKVQITVNYPP-YITDVKNAQSPVGRPATLRCKAMAVPPAEFEWY 244

  Fly   349 RGEGPIIHDSHKYKVEATVGLPAYKTHMKLTII---NVSSGDDGIYKCVAKNPRGETDGIIRL 408
            :       |..:..:..|.|| :.||....::|   ||:|...|.|.|:|.|..|..:..:||
 Frog   245 K-------DEKRRLISGTEGL-SIKTESSWSVIVFSNVTSRHYGNYTCLASNKLGSFNSSLRL 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/98 (28%)
Ig 130..200 CDD:143165 17/71 (24%)
I-set 226..310 CDD:254352 32/87 (37%)
IGc2 233..298 CDD:197706 26/68 (38%)
Ig 313..410 CDD:299845 27/100 (27%)
IG_like 325..410 CDD:214653 25/88 (28%)
iglon5XP_002938252.1 Ig 31..123 CDD:299845 26/99 (26%)
IG_like 35..123 CDD:214653 26/95 (27%)
Ig 126..207 CDD:299845 34/96 (35%)
I-set 128..207 CDD:254352 33/94 (35%)
I-set 210..299 CDD:254352 26/98 (27%)
Ig 227..298 CDD:143165 21/79 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80554475
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.