DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and cntn2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_017947056.1 Gene:cntn2 XenbaseID:XB-GENE-6070188 Length:911 Species:Xenopus tropicalis

Alignment Length:491 Identity:115/492 (23%)
Similarity:193/492 (39%) Gaps:102/492 (21%)


  Fly     6 WHLIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVAT---GVVPNFGGAA 67
            |.|.|..|.|.|   |.:.:::       ||.....|..|.||....:.:|:   |.|.:...:.
 Frog    42 WQLNGTELNLTA---DPSYRLV-------GGNLAISGPTQSKHAGTYQCIASNPKGTVLSSEASL 96

  Fly    68 GNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEE-PEF-----TEYIENVTVPA 126
            ..|.....|.....|.....|...::......:.|..:...::.| |.|     ..::..||   
 Frog    97 RFGYLQEFPAEQRDTVKVTEGWGVMLACNPPKHYPGLSYRWLLNEFPTFLNTDNRRFVSQVT--- 158

  Fly   127 GRNVKLGCSVK-NLGSY------------KVAWMHFEQSAILTVHNHVITRN--PRISV-----T 171
             .|:.:..:|| :.|:|            |..:..|.|   |.|::.|..|.  |.|.|     |
 Frog   159 -GNLYVAQTVKEDEGAYSCLTTSHISFTTKSVYSSFTQ---LNVNSEVKPRTYAPSIKVRFPGET 219

  Fly   172 HDKHDR--------------HRTW----------------YLHINNVHEEDRGRYMCQ-INTVTA 205
            :..:.:              |..|                .||..::..|:.|.|.|: :|:..:
 Frog   220 YALYGQAVFLECFAFGNPVPHIRWRKVDGTLPPRLLVIDPVLHFPSITFEEDGTYECEAVNSEGS 284

  Fly   206 KTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVN 270
            .|..|.:.|...|.....::.::..:  |:::...|.|||.|||.|:|.||....:......|.|
 Frog   285 TTHQGRVIVQAQPEWLHVITDTEAKI--GSDLLWSCAASGKPRPTIRWLRDGKPLMTQVNIEITN 347

  Fly   271 EWEGDTLEITRISRLDMGAYLCIASN--GVPPTVSKRIKVSVDFPPMLLIP-HQLVGAPEGFNVT 332
                ..::.|.:|..|.|.|.|:|.|  |...|.:: :.|....|...|.| .:|:.|..|..|.
 Frog   348 ----GQIKFTSLSLHDSGMYQCVAENKHGTIYTTAE-LTVQALAPDFRLSPVKRLIPAARGGEVI 407

  Fly   333 IECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKN 397
            |:|...|.||.|..|::|. .::.:|.:..|.|         :..|.:.|:|..|:|.|.|.|:|
 Frog   408 IQCNPRAAPTPLILWSKGT-ELLFNSSRVTVTA---------NGTLILRNISRSDEGKYTCFAEN 462

  Fly   398 PRGETD--GIIRLYVSYPPTTASSGIYSTDTHWGEN 431
            ..|:::  |::.:..:...|.|.||   :|.:.|::
 Frog   463 IMGKSNSTGVLSVREATKITLAPSG---SDINQGDS 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/147 (20%)
Ig 130..200 CDD:143165 23/121 (19%)
I-set 226..310 CDD:254352 25/86 (29%)
IGc2 233..298 CDD:197706 23/67 (34%)
Ig 313..410 CDD:299845 29/100 (29%)
IG_like 325..410 CDD:214653 25/87 (29%)
cntn2XP_017947056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.