DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and nfasc

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_004910753.1 Gene:nfasc XenbaseID:XB-GENE-922969 Length:1338 Species:Xenopus tropicalis

Alignment Length:390 Identity:95/391 (24%)
Similarity:146/391 (37%) Gaps:109/391 (28%)


  Fly    43 TAQGKHPSGSKTVAT-GV---VPNFGGAAGNGAGGGGPVAGSGTGST--VVGSNGVIVAGGGANV 101
            |.|.|:|...|.:.| ||   .|.|             :..:||.|:  |:....:::....:.|
 Frog   235 TIQQKNPYTLKVLTTRGVPERTPTF-------------LLPTGTSSSKLVLRDEDLLLECIASGV 286

  Fly   102 PTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNP 166
            ||         |:...|.:...:|               |.|:.:.:|.::              
 Frog   287 PT---------PDIMWYKKGGELP---------------SRKLKFENFNKT-------------- 313

  Fly   167 RISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQI--------NTVTAKTQFGYLNVVVPPNIDDS 223
                            |.|..|.|||.|.|.||.        :|::.:.:      ..|..:|: 
 Frog   314 ----------------LRIIGVSEEDSGEYFCQASNKMGSIRHTISVRVK------AAPYWLDE- 355

  Fly   224 LSSSDVIVREGANISLRCRASGSPRPIIKW-KRDDNSRI-AINKNHIVNEWEGDTLEITRISRLD 286
              ..::|:..|.|..|.|||||||:|.|:| ...|.:.: |.|.|.   |..|||:....:...:
 Frog   356 --PKNLILAPGENGRLVCRASGSPKPTIQWFMNGDATEVGAPNPNF---EIAGDTIIFREVQSGN 415

  Fly   287 MGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIP-HQLVGAPEGFNVTIEC--FTEAHPTSLNYWT 348
            ...|.|.|||.....::......:|.|..:|.| :||:...|.....::|  |....|| |.::.
 Frog   416 SAVYQCNASNEHGYLLANAFVSILDVPSRMLGPRNQLIRVIEYNRTQLDCPFFGSPIPT-LRWFK 479

  Fly   349 RGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYP 413
            .|:|..: |...|:|.         .:..|.|..|...|.|.|.|||.|..|..:..:||.|..|
 Frog   480 NGQGSNL-DGGNYRVH---------ENGTLEINTVRKEDQGKYTCVATNILGNAENTVRLEVKEP 534

  Fly   414  413
             Frog   535  534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 15/104 (14%)
Ig 130..200 CDD:143165 13/70 (19%)
I-set 226..310 CDD:254352 27/86 (31%)
IGc2 233..298 CDD:197706 26/67 (39%)
Ig 313..410 CDD:299845 29/100 (29%)
IG_like 325..410 CDD:214653 24/87 (28%)
nfascXP_004910753.1 IG_like 62..149 CDD:214653
Ig 72..148 CDD:299845
Ig 153..245 CDD:299845 4/10 (40%)
IG_like 162..246 CDD:214653 5/11 (45%)
IG_like 266..346 CDD:214653 22/134 (16%)
Ig3_L1-CAM_like 277..347 CDD:143208 20/124 (16%)
IG_like 356..438 CDD:214653 27/85 (32%)
Ig 364..439 CDD:299845 26/78 (33%)
IGc2 462..521 CDD:197706 20/70 (29%)
IG_like 463..531 CDD:214653 23/79 (29%)
I-set 536..622 CDD:254352
Ig 551..622 CDD:299845
FN3 640..730 CDD:238020
FN3 742..820 CDD:214495
fn3 840..932 CDD:278470
FN3 944..1035 CDD:238020
fn3 1109..1178 CDD:278470
Bravo_FIGEY 1230..1314 CDD:290593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.