DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and chl1b

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_017212175.2 Gene:chl1b ZFINID:ZDB-GENE-091105-1 Length:1294 Species:Danio rerio

Alignment Length:449 Identity:101/450 (22%)
Similarity:169/450 (38%) Gaps:85/450 (19%)


  Fly   105 NLNIVVEE-PEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVH----NHVITR 164
            :.::.||| |||....::..|..|.:|.:.|.||......|.|         .|:    |.|.|.
Zfish   343 HFHVTVEEPPEFEIEPQSQLVTIGADVLIKCVVKGNPQPTVGW---------RVNGRPLNEVPTS 398

  Fly   165 NPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQI----NTVTAKTQFGYLNVVVPPNIDDSLS 225
            |.:|.         :...:.|:|.:.|:...|.|:.    .|:.|......:|:......:::|.
Zfish   399 NRKIL---------KDGTISIHNANPENSAVYQCEATNKHGTILANANIMIMNIQPLILTENNLQ 454

  Fly   226 SSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAY 290
            ...|   ||.::.:.|:...||...|.|.:.|::.....:...|:  :..:|||..:.:.|||.|
Zfish   455 YMAV---EGKSVVMHCKVFSSPASSITWSKADSANAVEGERFTVH--QNGSLEIHNVMKEDMGEY 514

  Fly   291 LCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLN----YWTRGE 351
            .|.|.| ....|:....:.|..|..::.|.:.:....|..:...|..|..|:..:    .|.: :
Zfish   515 SCFAQN-TEGKVAIAATLEVKDPTRIVDPPRDLRVLAGTTIQFSCQPEFDPSFGDDFEVLWEK-D 577

  Fly   352 GPIIHDSH--KYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPP 414
            |..::.|.  :|.:|..|          |.|||||.||.|.|.|||:.|..:...:.:|.|...|
Zfish   578 GIALNGSEDGRYILEDGV----------LEIINVSFGDQGFYACVARTPVDQDVAVAQLSVVDVP 632

  Fly   415 TTASSGIY------STDTHWGENGINNN----------YAYGGPDSTRSIYAQDKN--------- 454
            ......|.      |....|.....:|:          .:...|.|.|.:.....|         
Zfish   633 DPPEDVILSEHNGRSVKLQWTPGDDHNSSITEFVLEFEESQHEPGSWREMMRVPGNHHSAPLKLY 697

  Fly   455 ----TRYQ-SNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGARGHNP-SMAIAW 507
                .|:: |.:||:|........::.:.|    .:|.:.:.|:.....|.| .|.|.|
Zfish   698 GHVDYRFRVSAINEVGKGRPSQSTERYKTP----ASAPDKNPENIKIEAHLPHEMDINW 752

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/104 (21%)
Ig 130..200 CDD:143165 17/74 (23%)
I-set 226..310 CDD:254352 21/84 (25%)
IGc2 233..298 CDD:197706 19/65 (29%)
Ig 313..410 CDD:299845 27/103 (26%)
IG_like 325..410 CDD:214653 25/91 (27%)
chl1bXP_017212175.2 Ig 61..135 CDD:325142
Ig 138..231 CDD:325142
Ig 279..348 CDD:325142 0/5 (0%)
Ig 366..438 CDD:325142 20/90 (22%)
IG 454..533 CDD:214652 21/85 (25%)
I-set 538..628 CDD:333254 26/101 (26%)
FN3 632..722 CDD:238020 14/90 (16%)
FN3 734..815 CDD:238020 6/20 (30%)
FN3 832..931 CDD:238020
fn3 942..1022 CDD:306538
FN3 1070..1142 CDD:214495
Bravo_FIGEY 1196..1279 CDD:316405
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.