DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dscam

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001136135.1 Gene:dscam XenbaseID:XB-GENE-921689 Length:2008 Species:Xenopus tropicalis

Alignment Length:563 Identity:124/564 (22%)
Similarity:176/564 (31%) Gaps:148/564 (26%)


  Fly    74 GGPVAGSGTGSTVVGSNGV--IVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSV 136
            |..|:.....:|.|...||  ..|...|.|......|.|..|.....::|:|..|||:..:.|.|
 Frog   463 GNVVSYLNITNTQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRV 527

  Fly   137 KNLGSYKVAWMHFEQSAILTV-HNHVITRN-------------------------PRISVTHDKH 175
            .....|.:.|  ::.|.:|.. |..|...|                         |::|.:...|
 Frog   528 IGYPYYSIKW--YKNSNLLPFNHRQVAFENNGTLKLSDVQKDVDEGEYMCNVLVQPQLSTSQSVH 590

  Fly   176 ------------DRHR----------------------TWY----------------------LH 184
                        :..|                      ||.                      |.
 Frog   591 VTVKVPPFIQPFESQRFSIGQRVFIPCVVVSGDLPITITWQKDGRPIPASLGVTIDNIDFTSSLR 655

  Fly   185 INNVHEEDRGRYMC-QINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPR 248
            |:|:.....|.|.| ..|...|......|.|.|||......:..|.|.  |..:.|.|.|.|.|.
 Frog   656 ISNLSLMHNGNYTCIARNDAAAVEHQSQLIVRVPPRFVVQPTDQDGIY--GKAVILNCSAEGYPV 718

  Fly   249 PIIKWKRDD------------NSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPT 301
            |.|.||...            |.||.:..|        .:|.|..:...|.|.|||..||.|...
 Frog   719 PTIVWKYSKGAGVPQFQPIALNGRIQLLTN--------GSLLIKHVLEEDSGYYLCKVSNDVGAD 775

  Fly   302 VSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPI-IHDSHKYKVEA 365
            |||.:.::|..|.|:........|.:|....:.|........:..|.:.:..| :.:..:|.|..
 Frog   776 VSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRWEKEDRMINVPEMSRYLVST 840

  Fly   366 -TVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGI-----YST 424
             .||.....|   |.|:.....|.|.:.|.|.|..||..|||:|.|..||......|     .|.
 Frog   841 KEVGEEVIST---LQILPTVREDSGFFSCHAINSFGEDRGIIQLTVQEPPDPPEIEIREVRARSI 902

  Fly   425 DTHW-----GENGI--------NNNYAYGGPDSTRSIYAQ-------DKNTRYQSNL-----NEI 464
            ...|     |.:.|        |.:.::.....|:.:..|       |.:.....|:     |.|
 Frog   903 ALRWTMGFDGNSPITGYDIECKNKSDSWDSVQRTKDVSPQLNQATIIDLHPASTYNIRMYAKNRI 967

  Fly   465 GLSEQKSFLDKTQNPLLANGNANEADAESNGARGHNPSMAIAW 507
            |.||..:.|..|......:|...|...:...::    |:.:.|
 Frog   968 GKSEASNELTITTEEAAPDGPPQEVQLDPISSQ----SIRVTW 1006

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/179 (17%)
Ig 130..200 CDD:143165 21/153 (14%)
I-set 226..310 CDD:254352 29/96 (30%)
IGc2 233..298 CDD:197706 23/77 (30%)
Ig 313..410 CDD:299845 25/99 (25%)
IG_like 325..410 CDD:214653 23/87 (26%)
dscamNP_001136135.1 IG 44..113 CDD:214652
Ig 44..113 CDD:143165
Ig_2 121..217 CDD:290606
I-set 127..217 CDD:254352
IG_like 236..310 CDD:214653
Ig 238..300 CDD:299845
IG_like 320..400 CDD:214653
IGc2 328..388 CDD:197706
IG_like 417..501 CDD:214653 10/38 (26%)
Ig 424..493 CDD:143165 9/30 (30%)
I-set 504..595 CDD:254352 18/93 (19%)
IGc2 518..575 CDD:197706 11/59 (19%)
I-set 596..686 CDD:254352 12/90 (13%)
Ig 613..680 CDD:143165 10/67 (15%)
I-set 690..784 CDD:254352 30/104 (29%)
Ig7_DSCAM 707..784 CDD:143211 26/85 (31%)
IG 794..883 CDD:214652 23/92 (25%)
Ig 802..890 CDD:299845 25/91 (27%)
FN3 886..980 CDD:238020 19/94 (20%)
FN3 987..1084 CDD:238020 4/25 (16%)
FN3 1093..1185 CDD:238020
FN3 1190..1279 CDD:238020
IGc2 1302..1367 CDD:197706
FN3 1381..1471 CDD:238020
FN3 1485..1556 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.