DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and kirrel2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001135598.1 Gene:kirrel2 XenbaseID:XB-GENE-854070 Length:780 Species:Xenopus tropicalis

Alignment Length:476 Identity:109/477 (23%)
Similarity:163/477 (34%) Gaps:149/477 (31%)


  Fly   115 FTEYIENVTVPAGRNVKLGCSVKNLGSYK--VAWMHFEQSAILTVHNHVITRNPRISVTHD---- 173
            |::...:..:.||::|.|.|.|  :| |:  |.|   ....:.......:....|.||..|    
 Frog    24 FSQQPSDKVIVAGKSVTLPCVV--IG-YRGVVQW---TMDGLALGAERDLPGWSRYSVVGDPSLG 82

  Fly   174 KHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANI- 237
            :|:      |||..|...|...|.||......::|...|.|::||. |..:..|.|     ||: 
 Frog    83 EHN------LHIEGVELSDDAIYECQATQAALRSQRARLTVLLPPG-DPMIPGSPV-----ANVL 135

  Fly   238 -----SLRCRAS-GSPRPIIKWKRDDNS-RIAINKNHIV----NEWEGDTLEITRISRLDMG-AY 290
                 :|.|.|. ..|...|.|.||... ..|:....::    :|....:|.||. |..|.| :|
 Frog   136 LNVPYNLTCLAPVAKPAAEITWYRDGKKLDSAVYTKELLSDGKSEGSASSLLITP-SLADSGSSY 199

  Fly   291 LC-IASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNY-WTRGEGP 353
            .| :.:..:|....|.:.:||.:||.:.:..:.....||.:||..|...::|....| |.:|..|
 Frog   200 TCRVRNEALPEGREKSVTLSVQYPPKVTLSVEPPTITEGGSVTFLCGAVSNPEVTGYRWAKGGVP 264

  Fly   354 IIHDSHKYKVEA---------------TVGLPAYKTHMKLTI----------INVSSGDD----- 388
            :.....||.||.               :||.....|.:.:..          :.|..|||     
 Frog   265 LAVSGDKYTVEVDHTFFTAPVSCEVSNSVGASNVSTAVNVLFGPRLLTEPRPMTVDIGDDASFFC 329

  Fly   389 -------------------------------------GIYKCVAKNPR-GETDGIIRLYVSYPPT 415
                                                 |||.|.|..|| |.|:..:.|.|..||.
 Frog   330 GWTGNPTPTQFWSKKGTGEVLSNGNTLLLTKVTREDAGIYVCKAIVPRMGSTEKEVTLTVRGPPI 394

  Fly   416 TASSGIYSTDTHWGENGINNNYAYGG-----------PDSTRSIYAQDKNT-------RY--QSN 460
            ..|...|.|             ..||           |...|.::|.||.:       |:  ::.
 Frog   395 ITSEMHYET-------------TLGGKARMECLIESTPAPDRIVWAWDKQSLEDGSWGRFSVETE 446

  Fly   461 LNEIGL--------SEQKSFL 473
            :.|:|.        :||..||
 Frog   447 VTEVGAISVLVIDGAEQSDFL 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 26/102 (25%)
Ig 130..200 CDD:143165 21/76 (28%)
I-set 226..310 CDD:254352 25/98 (26%)
IGc2 233..298 CDD:197706 20/79 (25%)
Ig 313..410 CDD:299845 33/166 (20%)
IG_like 325..410 CDD:214653 31/154 (20%)
kirrel2NP_001135598.1 IG_like 28..117 CDD:214653 25/101 (25%)
IGc2 36..107 CDD:197706 22/83 (27%)
Ig2_KIRREL3-like 139..220 CDD:143236 21/82 (26%)
I-set 224..304 CDD:254352 18/80 (23%)
Ig_2 228..304 CDD:290606 17/76 (22%)
I-set 308..389 CDD:254352 14/81 (17%)
IGc2 321..373 CDD:197706 7/52 (13%)
Ig5_KIRREL3-like 391..488 CDD:143235 19/91 (21%)
Sox_C_TAD 639..>729 CDD:288887
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.