DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and cd4-2.1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001352990.1 Gene:cd4-2.1 ZFINID:ZDB-GENE-151021-1 Length:414 Species:Danio rerio

Alignment Length:270 Identity:60/271 (22%)
Similarity:103/271 (38%) Gaps:91/271 (34%)


  Fly   223 SLSSS--DVIVRE-GANISLRCRASGSPRPIIKWKRDDNSRIAI---------NKNHIVNEWE-- 273
            |:||.  ||:.:| |..:.|:|.|  .|...|:|:.::...|:|         ...|.|::..  
Zfish    10 SVSSGVCDVLYKEAGKEVILQCGA--PPNSDIEWRLNNIRLISITGKSGLRRKGSGHSVDKVNLY 72

  Fly   274 GDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTE 338
            ||||:|.|:...|.|.|.| |.:|...|:.. :.|.|...|:|:         :..:|.:.|..|
Zfish    73 GDTLKIPRLEPRDSGVYSC-AQSGKQYTLHV-VSVFVKPGPVLI---------QSSDVELHCNIE 126

  Fly   339 AHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKN------ 397
            ..|.:...|.|.....:||:               .|.|:.:.:|:|.|:|.:.|..::      
Zfish   127 GDPNTEVEWLRPPNDQVHDA---------------KHQKINLKSVTSSDEGKWTCKVEDLKLSVT 176

  Fly   398 --------------------------PRGETDGII--RLYVSYPPT--------TASSGIYSTDT 426
                                      ||..:..::  :....:.||        ||..|:     
Zfish   177 LTVVANHQINNVEVSERDDIELPCFLPRPVSQSVLGGKWKADHLPTVPFPTLKNTADEGL----- 236

  Fly   427 HWGENGINNN 436
            ||  :|:|::
Zfish   237 HW--DGVNSS 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653
Ig 130..200 CDD:143165
I-set 226..310 CDD:254352 29/98 (30%)
IGc2 233..298 CDD:197706 24/77 (31%)
Ig 313..410 CDD:299845 19/131 (15%)
IG_like 325..410 CDD:214653 17/119 (14%)
cd4-2.1NP_001352990.1 IG 18..94 CDD:214652 24/79 (30%)
Ig 119..180 CDD:319273 15/76 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.