DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and kirrel1b

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio

Alignment Length:546 Identity:120/547 (22%)
Similarity:184/547 (34%) Gaps:163/547 (30%)


  Fly   109 VVEEPEFTEYIENVTVPAGRNVKLGCSVKN---------------LGSYKVAWMHFEQSAILTVH 158
            |...|.|::...:.:|..|..|.|.|.|.|               :|....||..:....|:.|.
Zfish    21 VFSGPRFSQEPADQSVVIGERVVLSCVVFNYTGIVQWTKDGLALGIGEDLRAWPRYRVLRIMDVG 85

  Fly   159 NHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDS 223
            .                     :.|.|.:....|...|.||......:::...|.|::||:....
Zfish    86 Q---------------------YNLEITSADLTDDSLYECQATEAALRSRRAKLTVLIPPDGPVI 129

  Fly   224 LSSSDVIVREGANISLRCRASGS-PRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRL-- 285
            ..|.::::..|.:.:|.|.:.|: |...|:|.:|.   |.:...|...|...|...:|..|.|  
Zfish   130 EGSPEILLTAGTSFNLTCVSRGAKPMSTIEWYKDG---IIVEGAHTSTEVLSDRKRVTTKSFLEI 191

  Fly   286 -----DMGA-YLCIASNGVPPTVSKR--IKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPT 342
                 |.|. :.|:|||...| :.||  :.:::..||.:::..:.....||..|...|...|:|.
Zfish   192 QPMDTDTGRNFTCVASNLAAP-LGKRSTVTLNIHHPPTVILSIEPRSVLEGERVKFTCQATANPP 255

  Fly   343 SLNY-WTRGEGPIIHDSHKYKVEAT-----------------VGL-------------------- 369
            .:.| |.:| |.|:..:.:...|.|                 ||.                    
Zfish   256 IMGYRWAKG-GVILDGARESVFETTADHSFFTEPVSCLVFNAVGSTNVSILVDVHFGPILVVEPR 319

  Fly   370 --------------------PAYKTHMK------------LTIINVSSGDDGIYKCVAKNPR--- 399
                                |...|..|            |.:.:||..|.|.|.|.|..||   
Zfish   320 PVTVDVDSDVTLNCKWSGNPPLTLTWTKKGSSMVLSNSNQLFLKSVSQADAGQYVCKAIVPRIGV 384

  Fly   400 GETDGIIRLYVSYPPTTASSGI-YSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNT--RYQSNL 461
            |||:  :.|.|:.||..:|..| |:..   ||.|....|....|...:.::|..:|.  :.:..|
Zfish   385 GETE--VTLTVNGPPIISSEPIQYAVR---GEKGEIKCYIASTPPPDKIVWAWKENVWEKERGTL 444

  Fly   462 NEIGLSEQKSFLDKTQN----PLLANGNANEADAESNGARGHNPSMAIAWLFVVIATLLLTIR-- 520
            .|....||..  ..||.    ..|...|..|||.:|.    :|   ..||......|:::|:.  
Zfish   445 LERYTVEQSR--PATQGGAVLSTLTINNVMEADFQST----YN---CTAWNAFGPGTMIITLEET 500

  Fly   521 ---------------SAVGSSHSLSL 531
                           .:||||..|.|
Zfish   501 DIASEDIVPVGVIAGGSVGSSILLLL 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/111 (18%)
Ig 130..200 CDD:143165 16/85 (19%)
I-set 226..310 CDD:254352 25/95 (26%)
IGc2 233..298 CDD:197706 21/74 (28%)
Ig 313..410 CDD:299845 34/170 (20%)
IG_like 325..410 CDD:214653 32/158 (20%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.