DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and ncam2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_012811963.1 Gene:ncam2 XenbaseID:XB-GENE-1217730 Length:865 Species:Xenopus tropicalis

Alignment Length:501 Identity:127/502 (25%)
Similarity:191/502 (38%) Gaps:110/502 (22%)


  Fly    83 GSTVVGSNGVIVAGGG---------ANVPTSNL---------------NIVVEEPEFTEYIENVT 123
            |..::....|:|...|         |||..:.:               .:|:|..:...: |:|.
 Frog    87 GEKIISGQRVVVQREGIRSWLTIYKANVDDAGIYRCQATDSKGHAQEATVVLEIYQKLTF-EDVP 150

  Fly   124 VP----AGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWY-- 182
            .|    .|.|.::.|.|.:..:..|.|:                 |.|..|| |..||.....  
 Frog   151 SPQEFKRGENAEVLCLVSSSPAPMVRWL-----------------NNREDVT-DIDDRRFAMLPN 197

  Fly   183 --LHINNVHEEDRGRYMCQINT-VTAKTQFGYLNVV--VPPNIDDSLSSSDVIVREGANISLRCR 242
              |.|.|:.:.|.|.|.|:... |..:..|..::|:  |||.|.....|.:.......:|:|.||
 Frog   198 NNLQIKNISKRDEGIYRCEGRVEVRGEIDFRDISVIVNVPPEILAQQRSFNATADRLEDITLFCR 262

  Fly   243 ASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDT-LEITRISRLDMGAYLCIASNGVPPTVSKRI 306
            |:|||:|.|.|.|  |.:: :.:|...:..|.:| |.:..|...|.|.|:|.|:|....|..:  
 Frog   263 ATGSPKPYITWHR--NGKL-VEENEKYDLREDNTELTVKNIISTDSGLYVCRATNKAGFTEKQ-- 322

  Fly   307 KVSVDFPPMLLIPH--QLVGAP--EGFNVTIECFTEAHPTSLNYWTR-GEGPIIHDSHKY---KV 363
                .|..:.:.||  ||....  |..:||:.|..|..|.....|.| .:|.|.:|..|.   ::
 Frog   323 ----SFLQVFVQPHIVQLQNETTIEHGHVTLTCEAEGEPIPEITWKRSSDGMIFYDGDKSQDGRI 383

  Fly   364 EATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASS-GIYSTDTH 427
            |:|    .:.....|.|.:|...|.|.|.|.|.:..|.....:.|.:.|.|...|: .||.:   
 Frog   384 EST----GHHGKSSLHIKSVMLSDAGRYDCEAASRIGGHQKSMYLNIEYAPKFISNQTIYYS--- 441

  Fly   428 WGENGINNNY-AYGGPDSTRSIY-AQDKNTRYQSNLNEIGLSEQKSFLDKTQ-----NPLLAN-- 483
            |..|.||.:. ....|.|  ||| ::||......|:..|     |::.|..:     .||..|  
 Frog   442 WENNPINISCDVTSNPPS--SIYWSRDKLLLPARNITNI-----KTYRDGKRILLEITPLSDNDF 499

  Fly   484 GNANEADAESNGARGHNPSMAIAWLFVVIATLLLTIRSAVGSSHSL 529
            |..|.....|.|:|              |...:||:.....|.:.|
 Frog   500 GRYNCTAINSIGSR--------------IQEYILTLADVPSSPYGL 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 26/107 (24%)
Ig 130..200 CDD:143165 18/74 (24%)
I-set 226..310 CDD:254352 26/85 (31%)
IGc2 233..298 CDD:197706 24/66 (36%)
Ig 313..410 CDD:299845 28/105 (27%)
IG_like 325..410 CDD:214653 24/91 (26%)
ncam2XP_012811963.1 Ig 50..141 CDD:299845 9/54 (17%)
I-set 51..140 CDD:254352 9/53 (17%)
IG_like 150..234 CDD:214653 24/102 (24%)
IGc2 158..218 CDD:197706 20/78 (26%)
Ig 237..330 CDD:299845 30/102 (29%)
I-set 255..327 CDD:254352 26/81 (32%)
Ig 329..426 CDD:299845 28/101 (28%)
IG_like 337..426 CDD:214653 24/93 (26%)
IG_like 442..520 CDD:214653 25/99 (25%)
Ig 447..512 CDD:143165 20/72 (28%)
FN3 525..617 CDD:238020 2/8 (25%)
FN3 623..707 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.