DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and negr1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001106537.1 Gene:negr1 XenbaseID:XB-GENE-987949 Length:369 Species:Xenopus tropicalis

Alignment Length:318 Identity:97/319 (30%)
Similarity:142/319 (45%) Gaps:41/319 (13%)


  Fly   119 IENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV-THDKHDRHRTWY 182
            ::|:.|..|....|.|.::. |:.|.||::  :|:|:.......:.:||:|: |..|.:    :.
 Frog    46 VDNLVVRQGETAMLRCFLEE-GASKGAWLN--RSSIIFAGGDKWSVDPRVSIATSSKQE----YS 103

  Fly   183 LHINNVHEEDRGRYMCQINTV-TAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGS 246
            |.|..|...|.|.|.|.:.|. :.:|...:|.|.|.|.|.|  .|||:.|.||.|:||.|.|:|.
 Frog   104 LRIQKVDVSDDGPYTCSVQTEHSPRTLQVHLTVHVSPKIYD--ISSDMTVNEGTNVSLICLATGK 166

  Fly   247 PRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVD 311
            |.|.|.|:....|.....        .|..|:|..|:|...|.|.|.|.|.|.....|::||:|:
 Frog   167 PEPSISWRHISPSAKQFG--------SGQYLDIYGITRDQAGDYECSAENDVSFPDVKKVKVTVN 223

  Fly   312 FPPMLL--IPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKT 374
            |.|.:|  .|   .|...|....|.|.|.|.|..:..|.:||..:.:.....:::      .|.|
 Frog   224 FAPTILEITP---TGVSLGRTGLIRCETAAVPAPVFEWYKGEKKLTNGQRGIRIQ------NYNT 279

  Fly   375 HMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRL-----------YVSYPPTTASSGI 421
            ...||:.||:....|.|.|||.|..|.::..:.|           ..|..|:||..||
 Frog   280 RSILTVSNVTEEHFGNYTCVAVNKLGTSNASLPLNQIIEPSTTSPVTSSAPSTAQYGI 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/98 (28%)
Ig 130..200 CDD:143165 20/71 (28%)
I-set 226..310 CDD:254352 31/84 (37%)
IGc2 233..298 CDD:197706 23/65 (35%)
Ig 313..410 CDD:299845 27/110 (25%)
IG_like 325..410 CDD:214653 23/96 (24%)
negr1NP_001106537.1 Ig 44..136 CDD:325142 26/97 (27%)
Ig_3 140..208 CDD:316449 29/78 (37%)
IG_like 236..313 CDD:214653 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80620456
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.