DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and lsamp

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001096385.1 Gene:lsamp XenbaseID:XB-GENE-5759171 Length:334 Species:Xenopus tropicalis

Alignment Length:328 Identity:96/329 (29%)
Similarity:147/329 (45%) Gaps:41/329 (12%)


  Fly   110 VEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDK 174
            |...:|....:|:||..|....|.|.|::..| :|||::  :|.|:...:...:.:||:.:    
 Frog    26 VRSGDFNRSTDNITVRQGDTAILRCFVEDRSS-RVAWLN--RSGIIFAGDDKWSLDPRVEL---- 83

  Fly   175 HDRHRTWY-LHINNVHEEDRGRYMCQINTVT-AKTQFGYLNVVVPPNIDDSLSSSDVIVREGANI 237
            ..|....| |.|..|...|.|.|.|.:.|.. .||...||.|.|||.|  |..|:|:.|.||:|:
 Frog    84 EKRSLLEYSLRIQKVDVSDEGPYTCSVQTKQHTKTTQVYLIVQVPPKI--SNISADITVNEGSNV 146

  Fly   238 SLRCRASGSPRPIIKWKRDDNSRIAINKNHI---VNEWEGDT--LEITRISRLDMGAYLCIASNG 297
            :|.|.|.|.|.|:|.|:            |:   ..::||:.  |||..|:|...|.|.|.|:|.
 Frog   147 TLMCIAYGRPEPMITWR------------HLTPTARDFEGEEEFLEIQGITREQSGRYECKAANE 199

  Fly   298 VPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYK 362
            |.....|:::|:|::|| ::...:...|..|....:.|...|.|.....|.:.:         .:
 Frog   200 VASADVKQVRVTVNYPP-IITESKSNEATTGKQAILRCEASAVPAPDFEWYKDD---------TR 254

  Fly   363 VEATVGLPAYKTHMK--LTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTD 425
            :.:..||....|..:  |.:.||:....|.|.|||.|..|.|:..:.||:. |.|...|......
 Frog   255 INSAQGLEIRNTGSRSVLMVANVTEEHYGNYTCVAANKLGITNTSLYLYIG-PGTPIDSATSLAA 318

  Fly   426 THW 428
            :.|
 Frog   319 SLW 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/98 (31%)
Ig 130..200 CDD:143165 20/71 (28%)
I-set 226..310 CDD:254352 30/89 (34%)
IGc2 233..298 CDD:197706 24/70 (34%)
Ig 313..410 CDD:299845 24/99 (24%)
IG_like 325..410 CDD:214653 22/87 (25%)
lsampNP_001096385.1 Ig 35..125 CDD:299845 29/97 (30%)
IG_like 37..125 CDD:214653 29/95 (31%)
Ig 128..212 CDD:299845 34/98 (35%)
I-set 129..212 CDD:254352 33/97 (34%)
IG_like 221..304 CDD:214653 22/92 (24%)
IGc2 229..294 CDD:197706 17/74 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80608553
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.