DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and igsf9

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001090640.1 Gene:igsf9 XenbaseID:XB-GENE-989817 Length:1423 Species:Xenopus tropicalis

Alignment Length:439 Identity:105/440 (24%)
Similarity:162/440 (37%) Gaps:127/440 (29%)


  Fly   120 ENVTVPAGRNVKLGCSVKNLGS-----YKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHR 179
            :.|....|.:..||||:.:..:     |.:.|:.|  ..:|.:.......:||:    |.....|
 Frog    26 QTVVGRVGESTVLGCSLLHQDAGRPPLYVIEWVRF--GFMLPIFIKFGLYSPRV----DPQYLGR 84

  Fly   180 TWY-----LHINNVHEEDRGRYMCQI-----NTVTAKTQFG---YLNVVVPPNIDDSLSSSDVIV 231
            |..     |||.::..||:|.|.|::     :......|.|   :|.|..||:..:: ..:.|.|
 Frog    85 TRIEEGASLHIESLRSEDQGWYECRVLFLDRHHGEEDFQNGTWVHLTVNSPPSFRET-PPTYVEV 148

  Fly   232 REGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN 296
            |.|..::|.|.|.|:|:|::.||||.   :.:.....|....| :|.|..:.|.:.|.|.|.|.:
 Frog   149 RVGDTLTLTCVAYGNPQPVVTWKRDG---VTLESGDKVQASNG-SLSIVGVERGNAGVYTCHAFS 209

  Fly   297 GVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIE------CFTEAHPTSLNY-WTRGEGPI 354
            . ...|:...:|.|..||::::|      ||...|.:.      |..||:|.:|.| |.:|...:
 Frog   210 D-EGEVTHTSRVLVQGPPIIVVP------PENTTVNVSQDAFLTCQAEAYPANLTYTWFQGSNNV 267

  Fly   355 I------------------------HDSHKYKVEATVGL--------------PAYKTHMKL-TI 380
            .                        .|:.||....:.|:              |||.|.|.. |.
 Frog   268 FLLNRLQPRVRILVDGSFLIQRVTPEDAGKYTCIPSNGMWKSPSASAYLTVLHPAYVTSMPAETY 332

  Fly   381 INVSSGDDGIYKC-VAKNP-----RGETDGIIRLYVSYPP-----------TTASS---GIYSTD 425
            :.:  |..|:.|| |..||     ....||.......||.           .|.:.   |||:..
 Frog   333 LPI--GMRGVIKCPVRANPPLLLVNWTKDGHALELDKYPGWYVDEDGSLVIATGNDDALGIYTCT 395

  Fly   426 THWGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKSFLD 474
            .:       |:|..||                .|...|:.|.|..||:|
 Frog   396 PY-------NSYGTGG----------------VSLPTEVILKEPPSFID 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/114 (24%)
Ig 130..200 CDD:143165 21/80 (26%)
I-set 226..310 CDD:254352 25/84 (30%)
IGc2 233..298 CDD:197706 20/65 (31%)
Ig 313..410 CDD:299845 33/149 (22%)
IG_like 325..410 CDD:214653 30/137 (22%)
igsf9NP_001090640.1 Ig 25..132 CDD:299845 26/112 (23%)
IG_like 25..110 CDD:214653 23/90 (26%)
I-set 136..222 CDD:254352 26/92 (28%)
IGc2 151..212 CDD:197706 20/66 (30%)
Ig_2 226..318 CDD:290606 17/98 (17%)
I-set 226..318 CDD:254352 17/98 (17%)
IG_like 328..407 CDD:214653 21/104 (20%)
Ig 340..402 CDD:299845 15/69 (22%)
IG_like 431..502 CDD:214653
Ig 439..502 CDD:299845
FN3 507..601 CDD:238020
FN3 624..714 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.