DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and vsig10

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001093564.2 Gene:vsig10 ZFINID:ZDB-GENE-030131-7476 Length:529 Species:Danio rerio

Alignment Length:407 Identity:85/408 (21%)
Similarity:148/408 (36%) Gaps:141/408 (35%)


  Fly   127 GRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEE 191
            |.|..|.|....:.:..|.:...:..|::...|   ..||.:.::..::.     :|.|:.:...
Zfish    33 GNNTTLHCLDHPVNASSVLYQWKKDGAVVATQN---PPNPSVHLSISENG-----FLRISGLQLI 89

  Fly   192 DRGRYMCQINT-------VTAKTQFGYLNVVVPP---NIDDS----LSSSDVIVREGANISLRCR 242
            |.|.|.|:...       ..:|.|   |.:...|   ::|.|    |::..:.|.:|:|::..|.
Zfish    90 DEGLYECESQAKGGRSWQTLSKIQ---LTI
AAGPTGVSLDISPATFLNNGTLFVHKGSNVNFSCS 151

  Fly   243 ASGSPRPIIKWKRD----DN-SRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN------ 296
            :..:|...:.|..|    || .|...:|:.:       ...||.|..||.|.|.|.:.|      
Zfish   152 SESNPSQNLTWTVDNLASDNPEREFGSKSPL-------AFSITNIQPLDQGTYTCTSQNTLSRRT 209

  Fly   297 --------------------------------------GVP---------------PTV------ 302
                                                  |.|               ||:      
Zfish   210 ANKTQELLVYYAPERHPECSWELGDKPSDVLFICSWFGGYPVPTLTWQEVEGAAEGPTINLTTSQ 274

  Fly   303 -SKRIKVSVDFPPM-----------------------LLIPH----QLVGAPEGFNVTIECF-TE 338
             ::.:.|||:...:                       |.||:    .|..|.||.|:||.|. |.
Zfish   275 QTEELNVSVNRSILHDGDKVKCTGHHVTGVEKSCSFTLKIPYPTGQPLATALEGTNITISCTETS 339

  Fly   339 AHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETD 403
            :.|.:...|.:.: .:|.::.||.|:.  ..||    :.|||:||:..|:|:|.|.::||.|..:
Zfish   340 SLPPAKTVWKKND-DLIENTSKYIVQE--NRPA----LTLTIVNVTKADEGVYYCYSENPLGARE 397

  Fly   404 GIIRLYVSYPPTTASSG 420
              :.:|::. .|:|.:|
Zfish   398 --LEVYLNV-KTSAGNG 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 18/96 (19%)
Ig 130..200 CDD:143165 13/70 (19%)
I-set 226..310 CDD:254352 26/155 (17%)
IGc2 233..298 CDD:197706 20/114 (18%)
Ig 313..410 CDD:299845 33/125 (26%)
IG_like 325..410 CDD:214653 29/86 (34%)
vsig10NP_001093564.2 IG_like 28..116 CDD:214653 18/94 (19%)
Ig 32..104 CDD:299845 15/79 (19%)
IG_like 140..204 CDD:214653 20/71 (28%)
IGc2 143..203 CDD:197706 18/67 (27%)
IG_like 324..404 CDD:214653 29/89 (33%)
Ig 328..404 CDD:299845 27/85 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.