DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dscaml1

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_005157551.1 Gene:dscaml1 / 100002762 -ID:- Length:2158 Species:Danio rerio


Alignment Length:401 Identity:90/401 - (22%)
Similarity:162/401 - (40%) Gaps:78/401 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVI 162
            ||.:  |.|:.....|...:..::..|..||:::|.|......:..:.|:               
Zfish   282 GARL--SVLDPTESTPSVMDSFQSGEVQVGRSIELPCIASGYPNPTIRWL--------------- 329

  Fly   163 TRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQI-NTVTAKTQFGYLNVVVPPNIDDSLSS 226
             ::.| .:..|.....|...|.|:::..||.|.|:|:: |:..:|...|:|||:.|..:  :||.
Zfish   330 -KDGR-PLPADSRWTRRLTGLTISDLRLEDSGNYICEVTNSFGSKEVTGHLNVIEPLRV--TLSP 390

  Fly   227 SDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHI-VNEWEGDTLEITRISRLDMGAY 290
            .::.....:.:.|.|...|||...:.|.|  |:...:...|. :.....:||.||...:...|||
Zfish   391 KNLKTGISSTVILSCAVQGSPHFTVSWFR--NTEPIVPDQHFSIQGAHNETLFITAAQKRHSGAY 453

  Fly   291 LCIASNGVPPTVSKRIKVSVDFPPMLL----------IPHQLVGAPEGFNVTIECFTEAHPTSLN 345
            .|.|        :::.:.:.||..:||          ...::|...|.|  ::.|..:..|....
Zfish   454 QCFA--------TRKGQTAQDFSIILLEDGTPRIVSSFSERVVAPGEPF--SLMCAAKGAPPPTI 508

  Fly   346 YWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYV 410
            .||..:.|:..||.....:.|:...:..:|:.:|  |....|.|:|:|.|:|..|..:...|:.|
Zfish   509 TWTLDDEPVARDSAHRASQYTLSDGSTVSHVNVT--NPQIRDGGVYRCAARNSAGSAEYQARINV 571

  Fly   411 SYPPT-------TASSG-------------IYSTDTHWGENGINNNYAYGGPDSTRSIYAQD--- 452
            ..||:       ||.:|             .||  ..|.::|:..      ||:.|.:..::   
Zfish   572 RGPPSIRAMRNITAVAGRNTFINCRVIGYPYYS--IKWYKDGMLL------PDNHRQVVYENGTL 628

  Fly   453 KNTRYQSNLNE 463
            |.:..|..::|
Zfish   629 KLSDVQKGMDE 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/96 (23%)
Ig 130..200 CDD:143165 13/69 (19%)
I-set 226..310 CDD:254352 18/84 (21%)
IGc2 233..298 CDD:197706 18/65 (28%)
Ig 313..410 CDD:299845 24/106 (23%)
IG_like 325..410 CDD:214653 21/84 (25%)
dscaml1XP_005157551.1 IG_like 112..184 CDD:214653
Ig 112..183 CDD:143165
Ig 194..287 CDD:299845 2/6 (33%)
I-set 302..380 CDD:254352 20/94 (21%)
IGc2 309..370 CDD:197706 16/77 (21%)
IGc2 399..458 CDD:197706 18/68 (26%)
I-set 477..571 CDD:254352 22/97 (23%)
Ig 477..567 CDD:299845 21/93 (23%)
IG_like 581..662 CDD:214653 13/67 (19%)
IGc2 588..646 CDD:197706 11/60 (18%)
Ig 684..751 CDD:143165
IG_like 686..756 CDD:214653
I-set 760..855 CDD:254352
Ig7_DSCAM 778..855 CDD:143211
IG_like 865..956 CDD:214653
Ig 873..963 CDD:299845
FN3 959..1053 CDD:238020
FN3 1060..1157 CDD:238020
FN3 1165..1271 CDD:238020
FN3 1276..1367 CDD:238020
IGc2 1392..1455 CDD:197706
FN3 1486..1559 CDD:238020
FN3 1573..1649 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.