DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and URA6

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_012901.3 Gene:URA6 SGDID:S000001507 Length:204 Species:Saccharomyces cerevisiae

Alignment Length:213 Identity:55/214 (26%)
Similarity:102/214 (48%) Gaps:27/214 (13%)


  Fly   338 TQQPKLRQAAGPDESGSDLPPIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPR 402
            |.||    |..||:..     :|:|:||||:.|.|.|.|.| .:..:.|:|.|.|||  .:....
Yeast     6 TSQP----AFSPDQVS-----VIFVLGGPGAGKGTQCEKLV-KDYSFVHLSAGDLLR--AEQGRA 58

  Fly   403 ANTESFAVKEALAAGDMAPEK----SLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQ 463
            .:.....:|..:..|.:.|::    .|...:..|::..:.:  .::||:||.:.|...||....:
Yeast    59 GSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHK--FLIDGFPRKMDQAISFERDIVE 121

  Fly   464 RPPIILLDCSK-------LQLGR--GRIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGD 519
            ...|:..||.:       |:.|:  ||.||.:.|.::|...|:|.::|:::..:|.:::..|..|
Yeast   122 SKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCD 186

  Fly   520 TDSPSVQREFERLIRNHI 537
            .....|.::.:..||:.:
Yeast   187 RSVEDVYKDVQDAIRDSL 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 46/176 (26%)
ADK 359..521 CDD:238713 46/175 (26%)
URA6NP_012901.3 UMP_CMP_kin_fam 18..196 CDD:273576 47/183 (26%)
ADK 18..192 CDD:238713 46/179 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S511
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.