DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and Ak7

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_084463.1 Gene:Ak7 MGIID:1926051 Length:723 Species:Mus musculus

Alignment Length:542 Identity:93/543 (17%)
Similarity:184/543 (34%) Gaps:195/543 (36%)


  Fly   157 SEKIQVVNGVILISWRQSVLQKQIDYGAKLGHVVLSLAKMELENFFK-------NVMPVADYFDQ 214
            :|||.:..|.....:...|:...:.|||:.|         .|..|||       ..:||  :.|.
Mouse   193 AEKIVLKFGKNAKKFATYVVASGLQYGAEGG---------ILHTFFKMAWLGEVPALPV--FGDG 246

  Fly   215 SDMLLAVNGERAPTEVYKDFRTAVLDILSTLEN---QEAVMNGVTGMGRGIHDIPGSI--VSVDT 274
            ::.:.|::               |:|:...::|   ....::.:..:...:|.:...:  :|.:|
Mouse   247 TNCIPAIH---------------VVDLAGVIQNIIDHVPKLHYLVAVDEAVHTLEDLVKCISKNT 296

  Fly   275 APSQAQQGTQIAEDNDVTNASETAGTVLARDLAIERMDGGPNGAVTALKTGTTSADDD------- 332
            .|.:.|   ::.::|          ..|.:||..|.:|    ..:..|:.......::       
Mouse   297 GPGKIQ---KVPKEN----------AFLTKDLTQEYLD----HLLVNLRMEALFVKENFNIRWVA 344

  Fly   333 -SGVVVTQQPKLRQAAGPDESGSDLPPIIWVIGGPGSNKATL---CLKAVGLNPGWAHISVGRLL 393
             :|.|......|::.   .:|...||..|.::|.|...|:::   ..|...|:    ||.:..::
Mouse   345 QTGFVENINSILKEY---KQSRGLLPIKICILGPPAVGKSSISEELAKYYKLH----HIKMKDVI 402

  Fly   394 RNITDSAPRANTESFAVKEALAA----------GDMAPEK-----------SLNQLLETNLRQLR 437
                       .|:.|..||:.|          |:...|:           .:.:.:|.|..:|.
Mouse   403 -----------AEAIAKLEAIVAPKDSVEGEEEGEEEEEEENVDDAQELLDGIKESMEQNAGRLE 456

  Fly   438 DR-----------------TGIIVDGYPRNLQQVKYFENKYKQR-----------------PPII 468
            |:                 .|.|:||:|:...|.|...|:.::.                 |..:
Mouse   457 DQYIIRFVKEKLKSMPCRNQGFILDGFPKTYDQAKDLFNQEEEEEEEEIRGKIFPYDKLITPEFV 521

  Fly   469 L-LDCSKLQLGRGRI-------------------------------DDTVSSFRRRLELFREQTL 501
            . ||.|. :..:.|:                               |:||.::...||: ....:
Mouse   522 CGLDASD-EFLKERVMNLPESVVAGTHYSQDRFLRSLSHYRDINTDDETVFNYFDELEI-HPIHI 584

  Fly   502 PMLKILDTSNRLQIVD-----------GDTDSPSVQRE----FERLIRNHIQRLLNKTDDID--D 549
            .:.|:.|..|||.|..           |.||....:.|    .|||.:...|     |.:::  :
Mouse   585 DVGKLEDAQNRLAIKQLIKEIGKPRNYGLTDEEKAEEEKKAAEERLAKEAAQ-----TAELEHKE 644

  Fly   550 SANLGNQMMRNEQTDAILHDLE 571
            :..:..::.|.|:.:..|.:::
Mouse   645 AMEMAEKIARWEEWNKRLEEVK 666

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427 17/88 (19%)
ADK 70..230 CDD:238713 17/80 (21%)
aden_kin_iso1 358..521 CDD:130427 45/264 (17%)
ADK 359..521 CDD:238713 45/263 (17%)
Ak7NP_084463.1 WcaG <147..297 CDD:223528 23/130 (18%)
NADB_Rossmann <218..298 CDD:304358 18/106 (17%)
ADK 369..>548 CDD:238713 32/195 (16%)
Dpy-30 679..720 CDD:253069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121724606
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.