DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and Ak8

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_006498350.1 Gene:Ak8 MGIID:1916120 Length:508 Species:Mus musculus

Alignment Length:611 Identity:119/612 (19%)
Similarity:201/612 (33%) Gaps:248/612 (41%)


  Fly    23 NLTRNRNGQNA--------GDLEAAAAAGRLGSTNVGAIDMQNAGKIKFDPPKVPVIFVLGGPGS 79
            :|.||.:.:..        |.|.|..|...|.|             |:.|.|||   .:||.|.|
Mouse    49 HLRRNNDNEYTVIHASPPHGVLPAPRAQESLKS-------------IRIDVPKV---VILGPPAS 97

  Fly    80 GKVTHCDTFMQERRGVTHINMMDLLQQYAMGNDMQDFSQLSSKTVTEVLMLE---MKMAPAAKAY 141
            ||.|..                           |.....|:|..:|:..:||   .:::..||:|
Mouse    98 GKTTIA---------------------------MWLCKHLNSNLITKESLLEREFSRLSVEAKSY 135

  Fly   142 LISGYPRSMRDVVEYSEKIQVVNGVILISWRQSVLQKQI--DYGAKLGHVVLSLAKMELENFFKN 204
                          |....::.|.:::     |::|:::  |...:.|.::..:.:..       
Mouse   136 --------------YQVYKKIPNSILV-----SLVQERLNEDDCLRKGWILDGIPERR------- 174

  Fly   205 VMPVADYFDQSDMLLAVNGERAPTEVYKDFRTAVLDILSTLENQEAVMNGVTGMGRGIHDIPGSI 269
                    :|:.|:..:.  .||..|      .||:...|:..:..|       |:.|..:.|.|
Mouse   175 --------EQALMIQTLG--LAPKHV------IVLNAPDTVLIERNV-------GKRIDPVTGEI 216

  Fly   270 --VSVDTAP-----SQAQQGTQIAEDNDVTNASETAGTVLARDLAIERMDGGPNGAVTALKTGTT 327
              .:.|..|     ::.:|...|:|       .|||..:|.....|.|                 
Mouse   217 YHTTFDWPPEPEIQNRLRQPEGISE-------IETAKKLLEYHRHIIR----------------- 257

  Fly   328 SADDDSGVVVTQQPKLRQAAGPDESGSDL------------------PPIIWVIGGPGSNK---A 371
                    ::...||:.:....|:...|:                  .|.:.:.|..||.|   |
Mouse   258 --------ILPSYPKILKTISSDQPCVDVFYQALTYVQSGHRCNAPFTPKVLLCGPLGSGKRLQA 314

  Fly   372 TLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEALAA----GDM----------APE 422
            ||..:..||    .:||.|:||                 |||:||    |::          .|:
Mouse   315 TLLAQKYGL----VNISCGQLL-----------------KEAVAAKSSFGELIQPFFEKRMTVPD 358

  Fly   423 KSLNQLLETNLRQLRD--RTGIIVDGYPRNLQQVK------YFENK------------------- 460
            ..:.::|...:.| :|  :.|.::.|:||:|.|.:      |..|:                   
Mouse   359 SIITKVLADRMEQ-QDCIQKGWVLHGFPRDLDQARMLNSMGYNPNRVFFLSVPLDSILERLTLRR 422

  Fly   461 ------------YKQRPPIILLDCSKLQLGRGRIDDTVSSFRRRLELFREQTLPMLKILDTSNRL 513
                        ||. ||.|.:....||..:    |:....:.:.:||...:..:.:..|   |.
Mouse   423 TDPVTGERFHLMYKP-PPTIEVQVRLLQNPK----DSEEYIKLQTDLFYRNSGDLEQYYD---RA 479

  Fly   514 QIVDGDTDSPSVQREFERLIRNHIQR 539
            .||:||.|..:|....|..|.|.:.|
Mouse   480 IIVNGDQDPYTVFEYIESGIINPLPR 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427 29/176 (16%)
ADK 70..230 CDD:238713 26/165 (16%)
aden_kin_iso1 358..521 CDD:130427 49/219 (22%)
ADK 359..521 CDD:238713 48/218 (22%)
Ak8XP_006498350.1 adk 88..287 CDD:273569 52/310 (17%)
ADK 88..278 CDD:238713 52/301 (17%)
adk 299..497 CDD:273569 51/228 (22%)
ADK 299..491 CDD:238713 49/222 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121835620
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.