DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and AT3G60961

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001118870.1 Gene:AT3G60961 AraportID:AT3G60961 Length:136 Species:Arabidopsis thaliana

Alignment Length:124 Identity:34/125 (27%)
Similarity:61/125 (49%) Gaps:13/125 (10%)


  Fly   414 LAAGDMAPE----KSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIIL-LDCS 473
            :|.|.:.|.    |.|.:.:|.:. |:......::||:|||.:....|||..:..|..:| .||.
plant     2 IAEGRIVPSEITVKLLCKAMEESF-QVSGNDKFLIDGFPRNEENRIVFENVARIEPAFVLFFDCP 65

  Fly   474 KLQLGR-------GRIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSV 525
            :.:|.|       ||.||.:.:.::|.::|.|.|||::....:..:|:.::....|..|
plant    66 EEELERRIMSRNQGREDDNIETIKKRFKVFVESTLPIISYYQSKGKLRKINAAKSSEEV 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 32/119 (27%)
ADK 359..521 CDD:238713 32/119 (27%)
AT3G60961NP_001118870.1 ADK <1..124 CDD:238713 33/123 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1378291at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.