DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and Ak3

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_006527285.1 Gene:Ak3 / 56248 MGIID:1860835 Length:263 Species:Mus musculus


Alignment Length:280 Identity:59/280 - (21%)
Similarity:95/280 - (33%) Gaps:83/280 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 VIGGPGSNKATLC--------LKAVGLNPGWAHISVGRLLR-NITDSAPRANTE-SFAVKEALAA 416
            ::|.|||.|.|:.        ||         |:|.|.||| |:..     .|| ....|..:..
Mouse    12 IMGAPGSGKGTVSSRITKHFELK---------HLSSGDLLRQNMLQ-----GTEIGVLAKTFIDQ 62

  Fly   417 GDMAPEKSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIILLDCSKLQLGRGR 481
            |.:.|:..:.:|....|:.| .:...::||:||.|.|.:..:..|:                   
Mouse    63 GKLIPDDVMTRLALHELKTL-TQCSWLLDGFPRTLPQAEALDKVYQ------------------- 107

  Fly   482 IDDTVSSFRRRLELFREQTLPMLKILDTSNRLQI----------VDGDTDSPSVQREFERLIRNH 536
             .|||.:.....|:.: |.|....|...|.|:..          :|..|..|.:|||        
Mouse   108 -IDTVINLNVPFEVIK-QRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQRE-------- 162

  Fly   537 IQRLLNKTDDIDDSANLGNQMMR--NEQTDAILHDLETNVPGAVPTISHHVSMMNGHLKNRGSAV 599
                       ||......:.::  ..||:.:|...:.      ||...|..:....|::.|...
Mouse   163 -----------DDKPETVIKRLKAYEAQTEPVLQYYQK------PTARPHQEVPTSQLQHTGPCY 210

  Fly   600 GSGKPHGQMMNGHVPGRPGT 619
            .|....|...:..:|...|:
Mouse   211 TSPCELGSSYSSQLPYAEGS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 40/178 (22%)
ADK 359..521 CDD:238713 40/178 (22%)
Ak3XP_006527285.1 ADK 12..189 CDD:366082 50/231 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.